JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276766

Recombinant Mouse FZD1 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse FZD1 protein (His tag) is a Mouse Fragment protein, in the 1 to 248 aa range, expressed in HEK 293 cells, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Frizzled-1, Fz-1, mFz1, Fzd1

1 Images
SDS-PAGE - Recombinant Mouse FZD1 protein (His tag) (AB276766)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse FZD1 protein (His tag) (AB276766)

SDS-PAGE analysis of ab276766

Key facts

Purity

>97% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O70421

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAEEAAPSESRAAGRLSLELCAEALPGRREEVGHEDTASHRRPRADPRRWASGLLLLLWLLEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQH","proteinLength":"Fragment","predictedMolecularWeight":"21 kDa","actualMolecularWeight":null,"aminoAcidEnd":248,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O70421","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FZD1 also known as Frizzled-1 acts as a receptor for Wnt proteins and plays roles in a variety of signaling pathways. This transmembrane protein weighs approximately 72 kDa. FZD1 shuttles Wnt signals across the cell membrane initiating signaling cascades critical for cellular processes. Expressed across many tissue types FZD1 is often found in the heart lung kidney and brain indicating its widespread significance in diverse organs and systems.
Biological function summary

The Wnt/FZD1 signaling contributes to cell differentiation proliferation and migration being a part of the canonical Wnt pathway. It forms complexes with co-receptors like LRP5/6 to facilitate downstream signaling. Such signaling is fundamental for embryonic development influencing cell fate decisions and morphogenetic movements. Outside of development FZD1 pathways contribute to maintaining adult tissue homeostasis.

Pathways

FZD1 engages in both canonical and non-canonical Wnt signaling pathways. In the canonical Wnt pathway FZD1 collaborates with Dishevelled (DVL) proteins and subsequently affects beta-catenin stability influencing gene transcription. In non-canonical signaling FZD1 interfaces with proteins like Jun N-terminal kinase affecting pathways like planar cell polarity. These interactions emphasize FZD1’s versatility in modulating key cellular activities.

Deregulated FZD1 signaling associates with cancer and osteoporosis. In cancer aberrant Wnt/FZD1 activity can lead to uncontrolled cell growth and metastasis with beta-catenin playing a mediating role. In osteoporosis FZD1 influences bone density through its interactions with Wnt proteins and LRP5 which are important in bone mass regulation. Studies continue to explore FZD1 targeting as potential therapeutic strategies in these conditions.

Specifications

Form

Lyophilized

General info

Function

Receptor for Wnt proteins (PubMed : 15923619). Activated by WNT7B (PubMed : 15923619). Activated by WNT3A, WNT3, WNT1 and to a lesser extent WNT2, but apparently not by WNT4, WNT5A, WNT5B, WNT6, WNT7A or WNT7B (By similarity). Contradictory results showing activation by WNT7B have been described for mouse (PubMed : 15923619). Functions in the canonical Wnt/beta-catenin signaling pathway (PubMed : 15923619). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes (PubMed : 15923619). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).

Sequence similarities

Belongs to the G-protein coupled receptor Fz/Smo family.

Post-translational modifications

Ubiquitinated by ZNRF3, leading to its degradation by the proteasome.

Product protocols

Target data

Receptor for Wnt proteins (PubMed : 15923619). Activated by WNT7B (PubMed : 15923619). Activated by WNT3A, WNT3, WNT1 and to a lesser extent WNT2, but apparently not by WNT4, WNT5A, WNT5B, WNT6, WNT7A or WNT7B (By similarity). Contradictory results showing activation by WNT7B have been described for mouse (PubMed : 15923619). Functions in the canonical Wnt/beta-catenin signaling pathway (PubMed : 15923619). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes (PubMed : 15923619). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).
See full target information Fzd1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com