JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB137144

Recombinant Mouse Galectin 3 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Galectin 3 protein is a Mouse Full Length protein, in the 1 to 264 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Galectin-3, Gal-3, 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, IgE-binding protein, L-34 galactoside-binding lectin, Laminin-binding protein, Lectin L-29, Mac-2 antigen, CBP 35, Lgals3

5 Images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Mouse Galectin 3 protein (AB137144)
  • IHC-P

Unknown

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Mouse Galectin 3 protein (AB137144)

Immunohistochemical analysis of paraffin embedded Normal Human Uterus tissue using ab137144 showing +ve staining.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Mouse Galectin 3 protein (AB137144)
  • IHC-P

Unknown

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Mouse Galectin 3 protein (AB137144)

Immunohistochemical analysis of paraffin embedded Normal Human Tonsil tissue using ab137144 showing +ve staining.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Mouse Galectin 3 protein (AB137144)
  • IHC-P

Unknown

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Mouse Galectin 3 protein (AB137144)

Immunohistochemical analysis of paraffin embedded Normal Human Brain tissue using ab137144 showing -ve staining.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Mouse Galectin 3 protein (AB137144)
  • IHC-P

Unknown

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Recombinant Mouse Galectin 3 protein (AB137144)

Immunohistochemical analysis of paraffin embedded Human Breast carcinoma tissue using ab137144 showing +ve staining.

SDS-PAGE - Recombinant Mouse Galectin 3 protein (AB137144)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Galectin 3 protein (AB137144)

15% SDS-PAGE analysis of 3 μg ab137144.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P16110

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.06% EDTA, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI","proteinLength":"Full Length","predictedMolecularWeight":"29.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":264,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P16110","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Galectin-3 also known as LGALS3 is a protein belonging to the galectin family which are beta-galactoside-binding lectins. This protein has a molecular weight of about 30 kDa. It shows expression in various tissues including the heart liver and gastrointestinal tract. Galectin-3 plays a mechanical role in cell-cell adhesion cell-matrix interactions and modulating immune responses. Researchers often use galectin-3 ELISA kits to quantify its presence in different biological samples.
Biological function summary

Galectin-3 participates in cell growth regulation apoptosis and immune system modulation. Galectin-3 does not typically integrate into larger molecular complexes but it interacts with a variety of cell surface and extracellular matrix molecules. Its function influences processes like cell differentiation and angiogenesis where it can act as a regulator leveraging its ability to bind glycans on cell surfaces and matrix components.

Pathways

Galectin-3 contributes to the regulation of pathways such as the MAPK signaling pathway and the Wnt signaling pathway. In the MAPK pathway it influences cell proliferation and survival. Galectin-3 interacts with proteins like β-catenin in the Wnt pathway assisting in transcriptional regulation and cell fate determination. These pathways are vital for maintaining cellular homeostasis and responding to extracellular signals.

Galectin-3 has a strong connection to cancer and fibrosis. Its role in cancer involves promoting tumor cell survival metastasis and angiogenesis where it interacts with proteins like integrins to facilitate tumor progression. In fibrosis galectin-3 contributes to fibrotic tissue formation especially in conditions like idiopathic pulmonary fibrosis and cardiac fibrosis often associated with proteins such as TGF-β. Understanding these interactions helps in developing therapeutic strategies targeting galectin-3 in these diseases.

Specifications

Form

Liquid

Additional notes

ab137144 is purified using conventional chromatography techniques.

General info

Function

Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration (PubMed : 15181153). Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus : acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes (By similarity). When secreted, interacts with NK cell-activating receptor NCR3/NKp30 acting as an inhibitory ligand which antagonizes NK cell attack (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration (PubMed : 15181153). Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus : acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with TRIM16, coordinates the recognition of membrane damage with mobilization of the core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes (By similarity). When secreted, interacts with NK cell-activating receptor NCR3/NKp30 acting as an inhibitory ligand which antagonizes NK cell attack (By similarity).
See full target information Lgals3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com