JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB139256

Recombinant Mouse galectin 9/Gal-9 protein (denatured)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse galectin 9/Gal-9 protein (denatured) is a Human Full Length protein, in the 1 to 322 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Galectin-9, Gal-9, Ecalectin, Tumor antigen HOM-HD-21, LGALS9

1 Images
SDS-PAGE - Recombinant Mouse galectin 9/Gal-9 protein (denatured) (AB139256)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Mouse galectin 9/Gal-9 protein (denatured) (AB139256)

15% SDS-PAGE analysis of 3 µg ab139256.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O00182

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as galectin 9.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT","proteinLength":"Full Length","predictedMolecularWeight":"38.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":322,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O00182","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Galectin-9 also known as Gal-9 or LGALS9 is a β-galactoside-binding lectin with a molecular mass of around 40 kDa. It shows expression in various tissues including the thymus spleen and liver. The galectin-9 protein is involved in cell-cell and cell-matrix interactions where it binds to glycoproteins and glycolipids. Researchers commonly use methods like Galectin-9 ELISA to measure its levels in different biological samples.
Biological function summary

Galectins like galectin-9 play essential roles in regulating diverse immune responses. Galectin-9 acts within the immune system by modulating inflammation and apoptosis. It acts as both a pro-apoptotic factor for T cells and a protein mediator in innate immune functions. Galectin-9 proteins can form complexes with other lectins and cell surface receptors contributing to cellular signaling processes.

Pathways

Galectin-9 is integral to the immune system's functional networks. It participates in the T-cell regulation pathways and the innate immunity pathways. In these pathways it interacts with other proteins like TIM-3 which mediates T-cell apoptosis and contributes to immune tolerance. These interaction networks play important roles in maintaining the body's immune homeostasis.

Galectin-9 has associations with autoimmune diseases and cancer. Its regulatory effects on T cells connect it to autoimmune conditions where abnormal T-cell activation occurs. In cancer the alteration in galectin-9 expression levels affects tumor immunity. The interaction of galectin-9 with other proteins like TIM-3 is important in cancer progression making it a target of interest for therapeutic interventions.

Specifications

Form

Liquid

General info

Function

Binds galactosides (PubMed : 18005988). Has high affinity for the Forssman pentasaccharide (PubMed : 18005988). Ligand for HAVCR2/TIM3 (PubMed : 16286920). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (PubMed : 16286920). Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (By similarity). Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed : 21670307). Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (By similarity). Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (PubMed : 23817958). Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (PubMed : 20209097). Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (PubMed : 16116184, PubMed : 24465902). Inhibits degranulation and induces apoptosis of mast cells (PubMed : 24465902). Induces maturation and migration of dendritic cells (PubMed : 16116184, PubMed : 25754930). Inhibits natural killer (NK) cell function (PubMed : 23408620). Can transform NK cell phenotype from peripheral to decidual during pregnancy (PubMed : 25578313). Astrocyte derived galectin-9 enhances microglial TNF production (By similarity). May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (By similarity). Highly selective to the anion urate (By similarity).. Isoform 2. Acts as an eosinophil chemoattractant (PubMed : 9642261). It also inhibits angiogenesis (PubMed : 24333696). Suppresses IFNG production by natural killer cells (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Binds galactosides (PubMed : 18005988). Has high affinity for the Forssman pentasaccharide (PubMed : 18005988). Ligand for HAVCR2/TIM3 (PubMed : 16286920). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (PubMed : 16286920). Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (By similarity). Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed : 21670307). Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (By similarity). Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (PubMed : 23817958). Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (PubMed : 20209097). Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (PubMed : 16116184, PubMed : 24465902). Inhibits degranulation and induces apoptosis of mast cells (PubMed : 24465902). Induces maturation and migration of dendritic cells (PubMed : 16116184, PubMed : 25754930). Inhibits natural killer (NK) cell function (PubMed : 23408620). Can transform NK cell phenotype from peripheral to decidual during pregnancy (PubMed : 25578313). Astrocyte derived galectin-9 enhances microglial TNF production (By similarity). May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (By similarity). Highly selective to the anion urate (By similarity).. Isoform 2. Acts as an eosinophil chemoattractant (PubMed : 9642261). It also inhibits angiogenesis (PubMed : 24333696). Suppresses IFNG production by natural killer cells (By similarity).
See full target information LGALS9

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com