JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB202199

Recombinant Mouse GDF15 protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Mouse GDF15 protein (denatured) (His tag N-Terminus) is a Mouse Full Length protein, in the 189 to 303 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Mic1, Sbf, Gdf15, Growth/differentiation factor 15, GDF-15, Macrophage inhibitory cytokine 1, MIC-1

1 Images
SDS-PAGE - Recombinant Mouse GDF15 protein (denatured) (AB202199)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse GDF15 protein (denatured) (AB202199)

SDS-PAGE analysis of Recombinant Human GDF15 protein (ab202199), under reducing conditions. Proteins visualized by coomassie blue stain.

Lane 1 : Molecular Weight Standards

Lane 2 : 3 μg Recombinant Human GDF15 protein

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9Z0J7

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 8 Constituents: 90% Phosphate Buffer, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA","proteinLength":"Full Length","predictedMolecularWeight":"14.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":303,"aminoAcidStart":189,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9Z0J7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Hormone produced in response to various stresses to confer information about those stresses to the brain, and trigger an aversive response, characterized by nausea and/or loss of appetite (PubMed : 23468844, PubMed : 27986797, PubMed : 28572090, PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 29026214, PubMed : 29046435, PubMed : 30639358, PubMed : 31875646, PubMed : 31928886, PubMed : 32026535, PubMed : 32694673, PubMed : 32723474, PubMed : 33589633, PubMed : 33593916, PubMed : 33758420, PubMed : 34187898, PubMed : 36465107, PubMed : 37433299, PubMed : 37437602, PubMed : 38056430, PubMed : 38092039). The aversive response is both required to reduce continuing exposure to those stresses at the time of exposure and to promote avoidance behavior in the future (PubMed : 23468844, PubMed : 28572090, PubMed : 28846097, PubMed : 28846099, PubMed : 28953886, PubMed : 29046435, PubMed : 30639358, PubMed : 33589633, PubMed : 33593916, PubMed : 37437602, PubMed : 38092039). Acts by binding to its receptor, GFRAL, activating GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem (PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 31152154, PubMed : 31928886, PubMed : 33593916, PubMed : 37380764). It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes responses to stressful conditions (PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886). The GDF15-GFRAL signal induces expression of genes involved in metabolism, such as lipid metabolism in adipose tissues (PubMed : 27986797, PubMed : 32661391). Required for avoidance behavior in response to food allergens : induced downstream of mast cell activation to promote aversion and minimize harmful effects of exposure to noxious substances (PubMed : 37437602). In addition to suppress appetite, also promotes weight loss by enhancing energy expenditure in muscle : acts by increasing calcium futile cycling in muscle (PubMed : 37380764). Contributes to the effect of metformin, an anti-diabetic drug, on appetite reduction and weight loss : produced in the kidney in response to metformin treatment, thereby activating the GDF15-GFRAL response, leading to reduced appetite and weight (PubMed : 31875646, PubMed : 32694673, PubMed : 36001956). Produced in response to anticancer drugs, such as camptothecin or cisplatin, promoting nausea and contributing to malnutrition (PubMed : 31928886, PubMed : 33207247, PubMed : 35202387). Overproduced in many cancers, promoting anorexia in cancer (cachexia) (PubMed : 17982462, PubMed : 32661391, PubMed : 32723474). Responsible for the risk of nausea during pregnancy : high levels of GDF15 during pregnancy, mostly originating from embryos, are associated with increased nausea (PubMed : 38092039). Maternal sensitivity to nausea is probably determined by pre-pregnancy exposure to GDF15, females with naturally high level of GDF15 being less susceptible to nausea than female mice with low levels of GDF15 before pregnancy (By similarity). Promotes metabolic adaptation in response to systemic inflammation caused by bacterial and viral infections in order to promote tissue tolerance and prevent tissue damage (By similarity). Required for tissue tolerance in response to myocardial infarction by acting as an inhibitor of leukocyte integring activation, thereby protecting against cardiac rupture (PubMed : 21516086). Inhibits growth hormone signaling on hepatocytes (PubMed : 28572090).

Sequence similarities

Belongs to the TGF-beta family.

Product protocols

Target data

Hormone produced in response to various stresses to confer information about those stresses to the brain, and trigger an aversive response, characterized by nausea and/or loss of appetite (PubMed : 23468844, PubMed : 27986797, PubMed : 28572090, PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 29026214, PubMed : 29046435, PubMed : 30639358, PubMed : 31875646, PubMed : 31928886, PubMed : 32026535, PubMed : 32694673, PubMed : 32723474, PubMed : 33589633, PubMed : 33593916, PubMed : 33758420, PubMed : 34187898, PubMed : 36465107, PubMed : 37433299, PubMed : 37437602, PubMed : 38056430, PubMed : 38092039). The aversive response is both required to reduce continuing exposure to those stresses at the time of exposure and to promote avoidance behavior in the future (PubMed : 23468844, PubMed : 28572090, PubMed : 28846097, PubMed : 28846099, PubMed : 28953886, PubMed : 29046435, PubMed : 30639358, PubMed : 33589633, PubMed : 33593916, PubMed : 37437602, PubMed : 38092039). Acts by binding to its receptor, GFRAL, activating GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem (PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 31152154, PubMed : 31928886, PubMed : 33593916, PubMed : 37380764). It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes responses to stressful conditions (PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886). The GDF15-GFRAL signal induces expression of genes involved in metabolism, such as lipid metabolism in adipose tissues (PubMed : 27986797, PubMed : 32661391). Required for avoidance behavior in response to food allergens : induced downstream of mast cell activation to promote aversion and minimize harmful effects of exposure to noxious substances (PubMed : 37437602). In addition to suppress appetite, also promotes weight loss by enhancing energy expenditure in muscle : acts by increasing calcium futile cycling in muscle (PubMed : 37380764). Contributes to the effect of metformin, an anti-diabetic drug, on appetite reduction and weight loss : produced in the kidney in response to metformin treatment, thereby activating the GDF15-GFRAL response, leading to reduced appetite and weight (PubMed : 31875646, PubMed : 32694673, PubMed : 36001956). Produced in response to anticancer drugs, such as camptothecin or cisplatin, promoting nausea and contributing to malnutrition (PubMed : 31928886, PubMed : 33207247, PubMed : 35202387). Overproduced in many cancers, promoting anorexia in cancer (cachexia) (PubMed : 17982462, PubMed : 32661391, PubMed : 32723474). Responsible for the risk of nausea during pregnancy : high levels of GDF15 during pregnancy, mostly originating from embryos, are associated with increased nausea (PubMed : 38092039). Maternal sensitivity to nausea is probably determined by pre-pregnancy exposure to GDF15, females with naturally high level of GDF15 being less susceptible to nausea than female mice with low levels of GDF15 before pregnancy (By similarity). Promotes metabolic adaptation in response to systemic inflammation caused by bacterial and viral infections in order to promote tissue tolerance and prevent tissue damage (By similarity). Required for tissue tolerance in response to myocardial infarction by acting as an inhibitor of leukocyte integring activation, thereby protecting against cardiac rupture (PubMed : 21516086). Inhibits growth hormone signaling on hepatocytes (PubMed : 28572090).
See full target information Gdf15

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Cell research 35:117-131 PubMed39748047

2025

Neurotensin-neurotensin receptor 2 signaling in adipocytes suppresses food intake through regulating ceramide metabolism.

Applications

Unspecified application

Species

Unspecified reactive species

Wei Fu,Yuanting Lai,Kexin Li,Yue Yang,Xiao Guo,Qifan Gong,Xiaofeng Zhou,Liying Zhou,Cenxi Liu,Zhi Zhang,Jisun So,Yufeng Zhang,Lin Huang,Guangxing Lu,Chuanyou Yi,Qichu Wang,Chenyu Fan,Chao Liu,Jiaxing Wang,Haiyi Yu,Yimin Zhao,Tao Huang,Hyun Cheol Roh,Tiemin Liu,Huiru Tang,Jianping Qi,Ming Xu,Yan Zheng,He Huang,Jin Li

Frontiers in aging neuroscience 14:905115 PubMed35860670

2022

Growth Differentiation Factor 15 Regulates Oxidative Stress-Dependent Ferroptosis Post Spinal Cord Injury by Stabilizing the p62-Keap1-Nrf2 Signaling Pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Mingjie Xia,Qinyang Zhang,Yanan Zhang,Rulin Li,Tianyu Zhao,Lingxia Chen,Qiangxian Liu,Shengnai Zheng,Haijun Li,Zhanyang Qian,Lei Yang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com