JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259385

Recombinant mouse GM-CSF protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse GM-CSF protein (Active) is a Mouse Full Length protein, in the 17 to 141 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, Cell Culture, HPLC.

View Alternative Names

Csfgm, Csf2, Granulocyte-macrophage colony-stimulating factor, GM-CSF, Colony-stimulating factor, CSF

4 Images
Mass Spectrometry - Recombinant mouse GM-CSF protein (Active) (AB259385)
  • Mass Spec

Unknown

Mass Spectrometry - Recombinant mouse GM-CSF protein (Active) (AB259385)

Mass – 1 Da (+237.23 Da : Pi[3]; + 203 Da : HexNAc[1]; +162 Da : Hex[1]) (Calc. mass 14211.77 Da).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant mouse GM-CSF protein (Active) (AB259385)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse GM-CSF protein (Active) (AB259385)

Fully biologically active when compared to standard. Determined by the dose dependant proliferation of MC/9 cells.

ED50 is ≤0.04 ng/mL, corresponding to a specific activity of 2.50 x 107 units/mg.

SDS-PAGE - Recombinant mouse GM-CSF protein (Active) (AB259385)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse GM-CSF protein (Active) (AB259385)

SDS-PAGE analysis of ab259385.

HPLC - Recombinant mouse GM-CSF protein (Active) (AB259385)
  • HPLC

Supplier Data

HPLC - Recombinant mouse GM-CSF protein (Active) (AB259385)

Purity >= 95%.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, FuncS, Cell Culture, SDS-PAGE, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. Determined by the dose dependant proliferation of MC/9 cells.

ED50 is ≤0.04 ng/mL, corresponding to a specific activity of 2.50 x 107 units/mg.

Accession

P01587

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

Sequence info

[{"sequence":"APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK","proteinLength":"Full Length","predictedMolecularWeight":"14.21 kDa","actualMolecularWeight":null,"aminoAcidEnd":141,"aminoAcidStart":17,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01587","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

GM-CSF also known as Granulocyte-Macrophage Colony-Stimulating Factor is a glycoprotein with a mass of approximately 23 kDa. This protein plays a mechanical role in stimulating the differentiation and proliferation of hematopoietic progenitor cells into granulocytes and macrophages. Its expression occurs in various cell types including macrophages T cells endothelial cells and fibroblasts. GM-CSF interacts with its specific receptor known as CSF2 receptor to exert its effects.
Biological function summary

GM-CSF influences the immune system by enhancing the functional capacity of mature neutrophils macrophages and eosinophils. GM-CSF protein acts alone and not as part of a larger protein complex. It is important in regulating immune responses and inflammation. Due to its role in promoting the survival and activation of these immune cells GM-CSF is important for mounting an effective immune defense in response to infections and other challenges.

Pathways

GM-CSF signaling is integral to the JAK-STAT pathway. This pathway is essential for transmitting signals from surface receptors like GM-CSF receptors into the nucleus thereby inducing gene expression that leads to cell survival and proliferation. GM-CSF also intersects with the ERK1/ERK2 MAPK pathway which is involved in regulating cellular processes such as division and differentiation. The GM-CSF receptor shares similarities with other cytokine receptors involved in these pathways making it related to various cytokines through its downstream signaling effects.

GM-CSF has a well-established connection to diseases like rheumatoid arthritis and multiple sclerosis. In rheumatoid arthritis overproduction of GM-CSF is linked to chronic inflammation and joint damage. In multiple sclerosis GM-CSF might contribute to the pathological immune responses against the central nervous system. Antibodies targeting GM-CSF or its receptor represent a therapeutic strategy for these autoimmune diseases. By modulating GM-CSF activity therapeutic approaches aim to reduce inflammation and autoimmunity highlighting the protein's importance in disease progression.

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

Sequence similarities

Belongs to the GM-CSF family.

Product protocols

Target data

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
See full target information Csf2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com