JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB280348

Recombinant mouse IGF1 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse IGF1 protein (Active) is a Full Length protein, in the 33 to 165 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.
4 Images
Functional Studies - Recombinant mouse IGF1 protein (Active) (AB280348)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse IGF1 protein (Active) (AB280348)

Fully biologically active determined by the dose dependent increase in MCF7 cell proliferation.

ED50 is ≤47.5 ng/mL, corresponding to a specifc activity of 0.021 x 106 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3379473-1

Mass Spectrometry - Recombinant mouse IGF1 protein (Active) (AB280348)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse IGF1 protein (Active) (AB280348)

Mass determination by ESI-TOF.

Predicted MW is 15077.3 Da (+/- 10 Da by ESI-TOF). Observed MW is 15077.37. Multiple O-glycosylation sites are present in the sequence and presented in the mass analysis.

SDS-PAGE - Recombinant mouse IGF1 protein (Active) (AB280348)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse IGF1 protein (Active) (AB280348)

SDS-PAGE analysis of ab280348.

HPLC - Recombinant mouse IGF1 protein (Active) (AB280348)
  • HPLC

Supplier Data

HPLC - Recombinant mouse IGF1 protein (Active) (AB280348)

HPLC analysis of ab280348.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, HPLC, SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent increase in MCF7 cell proliferation.

ED50 is ≤47.5 ng/mL, corresponding to a specifc activity of 0.021 x 106 units/mg.

Animal free

Yes

Carrier free

No

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARSIRAQRHTDMPKTQKSPSLSTNKKTKLQRRRKGEPKTHPEGEQEEVTEATRKIRGPREKRLG","proteinLength":"Full Length","predictedMolecularWeight":"15.08 kDa","actualMolecularWeight":"15.08 kDa","aminoAcidEnd":165,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":null,"tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The insulin-like growth factor 1 or IGF1 is a protein hormone that plays an important mechanical role in growth and development. Alternative names for IGF1 include somatomedin C. This protein has a mass of approximately 7.6 kDa and is mainly produced by the liver. IGF1 is expressed in a range of tissues including muscle bone and cartilage reflecting its importance in various physiological processes. Its production is stimulated by growth hormone and it acts in an autocrine and paracrine manner to exert its effects.
Biological function summary

IGF1 stimulates growth and proliferation of cells most notably impacting the development of the skeletal system and the regulation of apoptosis. It is not part of a larger protein complex but it interacts closely with IGF1 receptor to execute its functions. By binding to this receptor IGF1 activates intracellular signaling cascades that promote anabolic effects which include increased uptake of glucose and amino acids contributing to muscle and tissue growth.

Pathways

IGF1 operates within the PI3K-Akt and MAPK signaling pathways which are significant for cell survival and proliferation. Its interaction with proteins like IGF binding protein 3 (IGFBP3) modulates its availability and activity in the bloodstream. These pathways are critical for mediating the effects of growth hormone highlighting the role of IGF1 in systemic growth and metabolism regulation.

Alterations in IGF1 levels associate with growth abnormalities such as Laron syndrome and acromegaly. Laron syndrome results from the body's inability to use IGF1 properly due to receptor defects while acromegaly occurs from excessive IGF1 production often due to pituitary tumors. Furthermore aberrant IGF1 signaling connects to cancer development where it can drive tumor growth and metastasis. Drugs targeting IGF1 and its pathway components continue to be researched for therapeutic potential in these conditions.

Specifications

Form

Lyophilized

Additional notes

=95% Purity by HPLC.

General info

Product protocols

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com