JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259419

Recombinant mouse IL-12 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse IL-12 protein (Active) is a Mouse Full Length protein, in the 23 to 215 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, Cell Culture, HPLC.

View Alternative Names

Interleukin-12 subunit alpha, IL-12A, Cytotoxic lymphocyte maturation factor 35 kDa subunit, IL-12 subunit p35, CLMF p35, Il12a, Interleukin-12 subunit beta, IL-12B, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL-12 subunit p40, CLMF p40, Il12b

4 Images
Functional Studies - Recombinant mouse IL-12 protein (Active) (AB259419)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse IL-12 protein (Active) (AB259419)

Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of CTLL-2 cells is 1.96 ng/mL corresponding to a Specific Activity of 5.10 x 105 IU/mg.

Mass Spectrometry - Recombinant mouse IL-12 protein (Active) (AB259419)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse IL-12 protein (Active) (AB259419)

M + 0. 9 Da (calc mass 21762.1) and M + 1.6 Da (calc mass 35848.4); heterodimer

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

SDS-PAGE - Recombinant mouse IL-12 protein (Active) (AB259419)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse IL-12 protein (Active) (AB259419)

SDS-PAGE analysis of ab259419.

HPLC - Recombinant mouse IL-12 protein (Active) (AB259419)
  • HPLC

Supplier Data

HPLC - Recombinant mouse IL-12 protein (Active) (AB259419)

Purity : 100% (heterodimer)

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

Key facts

Purity

>95% SDS-PAGE

>= 95 % HPLC.

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, FuncS, SDS-PAGE, Cell Culture, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant Proliferation of CTLL-2 cells is 1.96 ng/mL corresponding to a Specific Activity of 5.10 x 105 IU/mg.

Accession

P43431

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

Sequence info

[{"linker":null,"sequence":"RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA","proteinLength":"Full Length","predictedMolecularWeight":"21.76 kDa","actualMolecularWeight":null,"aminoAcidEnd":215,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P43431","tags":[]},{"linker":null,"sequence":"MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS","proteinLength":"Full Length","predictedMolecularWeight":"35.85 kDa","actualMolecularWeight":null,"aminoAcidEnd":335,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P43432","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

General info

Function

Heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine. IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells (DCs) as well as macrophages and granulocytes and regulates T-cell and natural killer-cell responses, induces the production of interferon-gamma (IFN-gamma), favors the differentiation of T-helper 1 (Th1) cells and is an important link between innate resistance and adaptive immunity (PubMed : 8766560). Mechanistically, exerts its biological effects through a receptor composed of IL12R1 and IL12R2 subunits. Binding to the receptor results in the rapid tyrosine phosphorylation of a number of cellular substrates including the JAK family kinases TYK2 and JAK2. In turn, recruited STAT4 gets phosphorylated and translocates to the nucleus where it regulates cytokine/growth factor responsive genes (By similarity). As part of IL-35, plays essential roles in maintaining the immune homeostasis of the liver microenvironment and also functions as an immune-suppressive cytokine (PubMed : 18033300, PubMed : 30197594). Mediates biological events through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers. Signaling requires the transcription factors STAT1 and STAT4, which form a unique heterodimer that binds to distinct DNA sites (By similarity).

Sequence similarities

Belongs to the IL-6 superfamily.

Product protocols

Target data

Heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine. IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells (DCs) as well as macrophages and granulocytes and regulates T-cell and natural killer-cell responses, induces the production of interferon-gamma (IFN-gamma), favors the differentiation of T-helper 1 (Th1) cells and is an important link between innate resistance and adaptive immunity (PubMed : 8766560). Mechanistically, exerts its biological effects through a receptor composed of IL12R1 and IL12R2 subunits. Binding to the receptor results in the rapid tyrosine phosphorylation of a number of cellular substrates including the JAK family kinases TYK2 and JAK2. In turn, recruited STAT4 gets phosphorylated and translocates to the nucleus where it regulates cytokine/growth factor responsive genes (By similarity). As part of IL-35, plays essential roles in maintaining the immune homeostasis of the liver microenvironment and also functions as an immune-suppressive cytokine (PubMed : 18033300, PubMed : 30197594). Mediates biological events through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers. Signaling requires the transcription factors STAT1 and STAT4, which form a unique heterodimer that binds to distinct DNA sites (By similarity).
See full target information Il12a

Additional targets

Il12b

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com