JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB281805

Recombinant mouse IL-17A protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant mouse IL-17A protein (Active) is a Mouse Full Length protein, in the 26 to 158 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

Ctla8, Il17, Il17a, Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8

4 Images
Functional Studies - Recombinant mouse IL-17A protein (Active) (AB281805)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse IL-17A protein (Active) (AB281805)

Functional analysis of ab281805.

Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH/3T3 cells. ED50 for this effect is ≤9.835 ng/mL, corresponding to a specific activity of 10.16 x 104 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3387041-1

SDS-PAGE - Recombinant mouse IL-17A protein (Active) (AB281805)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse IL-17A protein (Active) (AB281805)

SDS-PAGE analysis of ab281805.

Mass Spectrometry - Recombinant mouse IL-17A protein (Active) (AB281805)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse IL-17A protein (Active) (AB281805)

Mass determination by ESI-TOF.

Predicted MW is 15035.21 Da. (+/- 10 Da by ESI-TOF). Observes MW is 15036.36 Da. Additional masses at 14965.35 is due to residual O-glycans.

HPLC - Recombinant mouse IL-17A protein (Active) (AB281805)
  • HPLC

Supplier Data

HPLC - Recombinant mouse IL-17A protein (Active) (AB281805)

HPLC analysis of ab281805.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE, HPLC, Cell Culture, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH/3T3 cells. ED50 for this effect is ≤9.835 ng/mL, corresponding to a specific activity of 10.16 x 104 units/mg.

Accession

Q62386

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

You may be interested in:

AB214028

Rat IL-17A ELISA Kit

5

1 Reviews

View product

We recommend this product because it’s often used in the same experiment or related research.

We advise that you always check the datasheet to ensure it fits your experiments, or contact ourtechnical teamfor help.

Sequence info

[{"sequence":"AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA","proteinLength":"Full Length","predictedMolecularWeight":"15.03 kDa","actualMolecularWeight":"15.03 kDa","aminoAcidEnd":158,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q62386","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

>=95% Purity by HPLC

General info

Function

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed : 18025225, PubMed : 19144317, PubMed : 26431948). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation (PubMed : 16200068, PubMed : 17911633, PubMed : 19144317, PubMed : 26431948). Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites (PubMed : 18025225). In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines (PubMed : 18025225, PubMed : 27923703). In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells (PubMed : 18157131). Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance (PubMed : 17372004, PubMed : 20364087, PubMed : 28709803). Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation (PubMed : 17470641, PubMed : 23255360). Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis (PubMed : 26431948). As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release (PubMed : 28709803). In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers (PubMed : 19144317). Involved in antiviral host defense through various mechanisms (PubMed : 21946434, PubMed : 26735852, PubMed : 27795421). Enhances immunity against West Nile virus by promoting T cell cytotoxicity (PubMed : 27795421). May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung (PubMed : 21946434). Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense (PubMed : 26735852).

Sequence similarities

Belongs to the IL-17 family.

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed : 18025225, PubMed : 19144317, PubMed : 26431948). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation (PubMed : 16200068, PubMed : 17911633, PubMed : 19144317, PubMed : 26431948). Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites (PubMed : 18025225). In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines (PubMed : 18025225, PubMed : 27923703). In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells (PubMed : 18157131). Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance (PubMed : 17372004, PubMed : 20364087, PubMed : 28709803). Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation (PubMed : 17470641, PubMed : 23255360). Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis (PubMed : 26431948). As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release (PubMed : 28709803). In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers (PubMed : 19144317). Involved in antiviral host defense through various mechanisms (PubMed : 21946434, PubMed : 26735852, PubMed : 27795421). Enhances immunity against West Nile virus by promoting T cell cytotoxicity (PubMed : 27795421). May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung (PubMed : 21946434). Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense (PubMed : 26735852).
See full target information Il17a

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Viruses 17: PubMed40006939

2025

ILC3 Function as a Double-Edged Sword in EV71 Infection.

Applications

Unspecified application

Species

Unspecified reactive species

Chang Zhang,Linlin Bao,Feifei Qi,Qi Lv,Fengdi Li,Chuan Qin
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com