JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259423

Recombinant mouse IL-23 protein (Active)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant mouse IL-23 protein (Active) is a Mouse Full Length protein, in the 22 to 196 aa range with >=95% purity, < 0.005 EU/µg endotoxin level and suitable for SDS-PAGE, Functinonal studies, Cell Culture and more. The predicted molecular weight of ab259423 protein is 19.7 kDa.

- Save time and ensure accurate results - use our IL-23 protein as a control
- Optimal protein bioactivity, stability and reproducibility
- Available in different sizes to fit your experimental needs

View Alternative Names

Interleukin-23 subunit alpha, IL-23 subunit alpha, IL-23-A, Interleukin-23 subunit p19, IL-23p19, Il23a

5 Images
Mass Spectrometry - Recombinant mouse IL-23 protein (Active) (AB259423)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse IL-23 protein (Active) (AB259423)

M + 2.62 Da (Calc. mass 35848.38 Da).

Functional Studies - Recombinant mouse IL-23 protein (Active) (AB259423)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse IL-23 protein (Active) (AB259423)

Fully biologically actives as determined by the dose-dependant secretion of IFN-γ by NK-92 cells.

The ED50 is 0.66 ng/mL corresponding to a specific activity of 1.52 x 106 IU/mg.

Mass Spectrometry - Recombinant mouse IL-23 protein (Active) (AB259423)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse IL-23 protein (Active) (AB259423)

M + 0.61 Da (Calc. mass 19716.39 Da).

SDS-PAGE - Recombinant mouse IL-23 protein (Active) (AB259423)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse IL-23 protein (Active) (AB259423)

SDS-PAGE analysis of ab259423.

HPLC - Recombinant mouse IL-23 protein (Active) (AB259423)
  • HPLC

Lab

HPLC - Recombinant mouse IL-23 protein (Active) (AB259423)

Purity >=95%.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, Mass Spec, SDS-PAGE, HPLC, Cell Culture

applications

Biologically active

Yes

Biological activity

Fully biologically active as determined by the dose-dependant secretion of IFN-γ by NK-92 cells.

The ED50 is 0.66 ng/mL corresponding to a specific activity of 1.52 x 106 IU/mg.

Accession

Q9EQ14

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant mouse IL-23 protein ab259423 as a control.

The ab259423 mouse IL-23 protein is sourced from HEK293 cells and can be used as a positive control in SDS-PAGE, mass spectrometry and HPLC.

Check out our protein gel staining guide for SDS-PAGE here

Premium Bioactive Protein range

The ab259423 mouse IL-23 protein is part of the premium bioactive protein range which are ideal for preclinical cell culture and functional studies. These recombinant proteins are of the highest activity, purity, and consistency, meeting rigorous biophysical characterization.

More premium bioactive proteins can be found here

Sequence info

[{"sequence":"","proteinLength":"Full Length","predictedMolecularWeight":"19.72 kDa","actualMolecularWeight":null,"aminoAcidEnd":196,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q9EQ14","tags":[]},{"sequence":"MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS","proteinLength":"Full Length","predictedMolecularWeight":"35.85 kDa","actualMolecularWeight":null,"aminoAcidEnd":335,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P43432","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of pro-inflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.. Associates with IL12B to form the pro-inflammatory cytokine IL-23 that plays different roles in innate and adaptive immunity (PubMed : 11114383, PubMed : 11390512, PubMed : 16670770). Released by antigen-presenting cells such as dendritic cells or macrophages, binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R to activate JAK2 and TYK2 which then phosphorylate the receptor to form a docking site leading to the phosphorylation of STAT3 and STAT4 (By similarity). This process leads to activation of several pathways including p38 MAPK or NF-kappa-B and promotes the production of pro-inflammatory cytokines such as interleukin-17A/IL17A (PubMed : 19900478). In turn, participates in the early and effective intracellular bacterial clearance (PubMed : 16157683). Promotes the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset that produces IL-17, as well as other IL-17-producing cells (PubMed : 16648837).

Sequence similarities

Belongs to the IL-6 superfamily.

Product protocols

Target data

Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of pro-inflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.. Associates with IL12B to form the pro-inflammatory cytokine IL-23 that plays different roles in innate and adaptive immunity (PubMed : 11114383, PubMed : 11390512, PubMed : 16670770). Released by antigen-presenting cells such as dendritic cells or macrophages, binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R to activate JAK2 and TYK2 which then phosphorylate the receptor to form a docking site leading to the phosphorylation of STAT3 and STAT4 (By similarity). This process leads to activation of several pathways including p38 MAPK or NF-kappa-B and promotes the production of pro-inflammatory cytokines such as interleukin-17A/IL17A (PubMed : 19900478). In turn, participates in the early and effective intracellular bacterial clearance (PubMed : 16157683). Promotes the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset that produces IL-17, as well as other IL-17-producing cells (PubMed : 16648837).
See full target information Il23a

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Frontiers in immunology 14:1230681 PubMed37781363

2023

Deciphering the mechanism of -induced chemoresistance in colorectal cancer: the important roles of MDSC recruitment and EMT activation.

Applications

Unspecified application

Species

Unspecified reactive species

Jinhua Gu,Xiaojun Lv,Wenwen Li,Guangcai Li,Xialian He,Ye Zhang,Lihong Shi,Xiaoqian Zhang

Experimental dermatology 33:e14862 PubMed37350230

2023

The opposite effect of tapinarof between IMQ and IL-23 induced psoriasis mouse models.

Applications

Unspecified application

Species

Unspecified reactive species

Xingyu Zhu,Ruomei Han,Xiaoxue Tian,Mathias Hochgerner,Hui Li,Jiucun Wang,Jingjing Xia
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com