JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB270066

Recombinant mouse IL-33 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse IL-33 protein (Active) is a Mouse Full Length protein in the 109 to 266 aa range with >95% purity, ≤ 0.005 EU/µg endotoxin level and suitable for SDS-PAGE, Functional studies, mass spectrometry, Cell Culture and HPLC.The predicted molecular weight of ab270066 protein is 17.62 kDa.

- Save time and ensure accurate results - use our recombinant mouse IL-33 as a control
- Optimal protein bioactivity and stability
- Available in different sizes to fit your experimental needs

View Alternative Names

Interleukin-33, IL-33, Il33

4 Images
Functional Studies - Recombinant mouse IL-33 protein (Active) (AB270066)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse IL-33 protein (Active) (AB270066)

Fully biologically active when compared to standard. Determined by the dose dependant proliferation of D10.G4.1 cells.

ED50 is ≤ 0.8747, corresponding to a specific activity of 1.14 x 106 units/mg.

Mass Spectrometry - Recombinant mouse IL-33 protein (Active) (AB270066)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse IL-33 protein (Active) (AB270066)

M+1.3 Da. Calc MW is17624.69 Da.

SDS-PAGE - Recombinant mouse IL-33 protein (Active) (AB270066)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse IL-33 protein (Active) (AB270066)

SDS-PAGE - Recombinant mouse IL-33 protein (Active) (ab270066).

Purity ≥95%.

HPLC - Recombinant mouse IL-33 protein (Active) (AB270066)
  • HPLC

Supplier Data

HPLC - Recombinant mouse IL-33 protein (Active) (AB270066)

Purity ≥95%.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, SDS-PAGE, HPLC, Cell Culture, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active when compared to standard. Determined by the dose dependant proliferation of D10.G4.1 cells.

ED50 is ≤ 0.8747, corresponding to a specific activity of 1.14 x 106 units/mg.

Accession

Q8BVZ5

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute with Phosphate buffered saline.Store lyophilized form at room temperature. Reconstitute, aliquot and store at -80°C for 12 months or +4°C for 1 week.Avoid repeated freeze-thaw. Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product.

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant mouse IL-33 protein ab270066 as a control.

The ab270066 mouse IL-33 protein is sourced from HEK293 cells and can be used as a positive control in SDS-PAGE, mass spectrometry and HPLC.

Check out our protein gel staining guide for SDS-PAGE here

Premium Bioactive Protein range

The ab270066 mouse IL-33 protein is part of the premium bioactive protein range which are ideal for preclinical cell culture and functional studies. These recombinant proteins are of the highest activity, purity, and consistency, meeting rigorous biophysical characterization.

More premium bioactive proteins can be found here

Sequence info

[{"sequence":"SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI","proteinLength":"Fragment","predictedMolecularWeight":"17.62 kDa","actualMolecularWeight":null,"aminoAcidEnd":266,"aminoAcidStart":109,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q8BVZ5","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
-20°C|Ambient
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Lyophilized

Additional notes

Purity =95% by HPLC.

General info

Function

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed : 29045903). Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines (By similarity). Also involved in activation of mast cells, basophils, eosinophils and natural killer cells (By similarity). Acts as an enhancer of polarization of alternatively activated macrophages (By similarity). Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury (By similarity). Induces rapid UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (PubMed : 34644537).. In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets (By similarity). This form is rapidely lost upon angiogenic or pro-inflammatory activation (By similarity).

Sequence similarities

Belongs to the IL-1 family. Highly divergent.

Post-translational modifications

The full-length protein can be released from cells and is able to signal via the IL1RL1/ST2 receptor (PubMed:16286016). However, proteolytic processing by CELA1, CSTG/cathepsin G and ELANE/neutrophil elastase produces C-terminal peptides that are more active than the unprocessed full-length protein (PubMed:22307629, PubMed:35749514). May also be proteolytically processed by calpains. Proteolytic cleavage mediated by apoptotic caspases including CASP3 and CASP7 results in IL33 inactivation (PubMed:16286016, PubMed:19465481). In vitro proteolytic cleavage by CASP1 was reported (PubMed:16286016) but could not be confirmed in vivo (PubMed:19465481) suggesting that IL33 is probably not a direct substrate for that caspase (PubMed:16286016, PubMed:19465481).

Subcellular localisation

Nucleus

Product protocols

Target data

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed : 29045903). Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines (By similarity). Also involved in activation of mast cells, basophils, eosinophils and natural killer cells (By similarity). Acts as an enhancer of polarization of alternatively activated macrophages (By similarity). Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury (By similarity). Induces rapid UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (PubMed : 34644537).. In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets (By similarity). This form is rapidely lost upon angiogenic or pro-inflammatory activation (By similarity).
See full target information Il33

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com