JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB215598

Recombinant Mouse IL1 Receptor I/IL-1R-1 protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse IL1 Receptor I/IL-1R-1 protein (Fc Chimera) is a Mouse Fragment protein, in the 20 to 338 aa range, expressed in Mammalian, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD121a, Il-1r1, Il1ra, Il1r1, Interleukin-1 receptor type 1, IL-1R-1, IL-1RT-1, IL-1RT1, CD121 antigen-like family member A, Interleukin-1 receptor alpha, Interleukin-1 receptor type I, p80, IL-1R-alpha

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Mammalian

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P13504

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in water

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as IL1 Receptor I.

Sequence info

[{"sequence":"LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFKIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK","proteinLength":"Fragment","predictedMolecularWeight":"64 kDa","actualMolecularWeight":null,"aminoAcidEnd":338,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"Mammalian","accessionNumber":"P13504","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The IL-1 Receptor I also known as IL-1R1 is a transmembrane protein with alternative names such as IL-1 receptor and IL-1 type I receptor. It acts as an important receptor for the pro-inflammatory cytokine Interleukin-1 (IL-1) family primarily IL-1α and IL-1β. IL-1R1 has a mass of approximately 80 kilodaltons and is expressed in a variety of cell types including endothelial cells epithelial cells and fibroblasts. It is also present on immune cells like monocytes and macrophages making it widespread in a vast range of tissues.
Biological function summary

IL-1R1 is a critical player in the initiation of immune responses serving as a component of the IL-1 signaling complex. When IL-1 binds to IL-1R1 it recruits the IL-1 receptor accessory protein (IL-1RAcP) to form a signaling complex that triggers downstream pathways. This interaction initiates a signaling cascade that activates nuclear factor-kappa B (NF-κB) and mitogen-activated protein kinases (MAPKs) promoting the expression of inflammatory genes and mediating immune and inflammatory responses.

Pathways

IL-1R1 is central to the inflammatory response and immune signaling pathways. The IL-1 receptor complex facilitates the activation of NF-κB which plays a role in the body's response to stress cytokines and pathogens. The receptor acts in close relation with other proteins like IL-1RAcP and IRAKs (Interleukin-1 receptor-associated kinases) in these pathways creating a robust immune signaling network that drives the inflammatory response.

IL-1R1 is closely associated with inflammatory conditions such as rheumatoid arthritis and inflammatory bowel disease. Increased IL-1R1 expression and signaling contribute to chronic inflammation in these diseases. The interaction of IL-1β with IL-1R1 and subsequently with proteins like NF-κB leads to the persistence of inflammatory signals. Moreover targeting IL-1R1 and related proteins offers potential therapeutic strategies in mitigating the symptoms and progression of inflammatory disorders.

Specifications

Form

Lyophilized

General info

Function

Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the coreceptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. Involved in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (By similarity).. Isoform 2. Unable to mediate canonical IL-1 signaling. Cooperates with IL1RAP isoform 3 to mediate IL1B-induced neuronal activity including IL1B-potentiated NMDA-induced calcium influx mediated by Akt kinase activation.

Sequence similarities

Belongs to the interleukin-1 receptor family.

Post-translational modifications

A soluble form (sIL1R1) is probably produced by proteolytic cleavage at the cell surface (shedding).. Rapidly phosphorylated on Tyr-499 in response to IL-1, which creates a SH2 binding site for the PI 3-kinase regulatory subunit PIK3R1.

Product protocols

Target data

Receptor for IL1A, IL1B and IL1RN. After binding to interleukin-1 associates with the coreceptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B, MAPK and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Binds ligands with comparable affinity and binding of antagonist IL1RN prevents association with IL1RAP to form a signaling complex. Involved in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (By similarity).. Isoform 2. Unable to mediate canonical IL-1 signaling. Cooperates with IL1RAP isoform 3 to mediate IL1B-induced neuronal activity including IL1B-potentiated NMDA-induced calcium influx mediated by Akt kinase activation.
See full target information Il1r1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com