JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB269194

Recombinant Mouse IL36 gamma/IL-1F9 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse IL36 gamma/IL-1F9 protein is a Mouse Full Length protein, in the 13 to 164 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Il1f9, Il36g, Interleukin-36 gamma, Interleukin-1 family member 9, IL-1F9

1 Images
SDS-PAGE - Recombinant Mouse IL36 gamma/IL-1F9 protein (AB269194)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Mouse IL36 gamma/IL-1F9 protein (AB269194)

SDS-PAGE analysis of ab269194 at 1ug/lane under (-) non-reducing and (+) reducing conditions. 4-20% Tris glycine gel. Stained with coomassie blue.

Key facts

Purity

>95% SDS-PAGE

nan

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q8R460

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in 10 mM HCl

Storage buffer

Constituents: 0.1% Trifluoroacetic acid

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS","proteinLength":"Full Length","predictedMolecularWeight":"19 kDa","actualMolecularWeight":null,"aminoAcidEnd":164,"aminoAcidStart":13,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8R460","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL36 gamma also known as IL-1F9 or IL-36 is a member of the interleukin-1 cytokine family. The protein weighs approximately 22 kDa. It is expressed highly in epithelial tissues such as keratinocytes in the skin bronchial tissues and intestinal lining. It acts mainly on nearby cells to influence immune responses through cytokine signaling.
Biological function summary

IL36 gamma plays a role in the immune and inflammatory responses. It operates as a cytokine that signals through the IL-1 receptor family leading to the activation of NF-kB and MAPK pathways. This member of the IL-1 family does not form a complex by itself but interacts with IL-36R to exert its functions. The protein influences processes such as cell proliferation differentiation and the regulation of immune responses to external pathogens or injuries.

Pathways

IL36 gamma is involved in inflammatory and immune signaling pathways. Within the immune response pathway it stimulates the production of other cytokines and pro-inflammatory molecules. IL36 gamma is associated with the IL-1 signaling pathway alongside other cytokines such as IL-1 and IL-18 which all contribute to immune modulation and inflammatory responses.

IL36 gamma has connections to psoriasis and inflammatory bowel disease. In psoriasis increased levels of IL36 gamma correlate with heightened skin inflammation and proliferation of keratinocytes. In inflammatory bowel disease IL36 gamma contributes to the inflammatory state of the gut. The activities of IL36 gamma often link with other cytokines such as TNF-alpha which collectively drive the inflammatory processes observed in these conditions.

General info

Function

Functions as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP (By similarity). Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4(+) T-cells and splenocytes.

Sequence similarities

Belongs to the IL-1 family.

Post-translational modifications

N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold) (PubMed:21965679). Proteolytically cleaved by cathepsin CTSG (By similarity).

Product protocols

Target data

Functions as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP (By similarity). Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4(+) T-cells and splenocytes.
See full target information Il36g

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com