JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB318254

Recombinant Mouse IL36 gamma/IL-1F9 protein (His Tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse IL36 gamma/IL-1F9 protein (His Tag) is a Mouse Full Length protein, in the 13 to 164 aa range, expressed in Escherichia coli, with <95%, <0.005 EU/µg endotoxin level, suitable for Mass Spec, SDS-PAGE.

View Alternative Names

Il1f9, Il36g, Interleukin-36 gamma, Interleukin-1 family member 9, IL-1F9

2 Images
Mass Spectrometry - Recombinant Mouse IL36 gamma/IL-1F9 protein (His Tag) (AB318254)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse IL36 gamma/IL-1F9 protein (His Tag) (AB318254)

Mass determination by ESI-TOF. Predicted MW is 20360.00 Da (+/- 10 Da by ESI-TOF). Observed MW is 20225.72Da.

SDS-PAGE - Recombinant Mouse IL36 gamma/IL-1F9 protein (His Tag) (AB318254)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse IL36 gamma/IL-1F9 protein (His Tag) (AB318254)

SDS-PAGE analysis of ab318254 under reducing conditions for 2ug protein.

Key facts

Purity

<95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Mass Spectrometry

LC-MS/MS

Accession

Q8R460

Animal free

Yes

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS, 6.4993% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.

Sequence info

[{"sequence":"GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS","proteinLength":"Full Length","predictedMolecularWeight":"20.36 kDa","actualMolecularWeight":"20.23 kDa","aminoAcidEnd":164,"aminoAcidStart":13,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q8R460","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL36 gamma also known as IL-1F9 or IL-36 is a member of the interleukin-1 cytokine family. The protein weighs approximately 22 kDa. It is expressed highly in epithelial tissues such as keratinocytes in the skin bronchial tissues and intestinal lining. It acts mainly on nearby cells to influence immune responses through cytokine signaling.
Biological function summary

IL36 gamma plays a role in the immune and inflammatory responses. It operates as a cytokine that signals through the IL-1 receptor family leading to the activation of NF-kB and MAPK pathways. This member of the IL-1 family does not form a complex by itself but interacts with IL-36R to exert its functions. The protein influences processes such as cell proliferation differentiation and the regulation of immune responses to external pathogens or injuries.

Pathways

IL36 gamma is involved in inflammatory and immune signaling pathways. Within the immune response pathway it stimulates the production of other cytokines and pro-inflammatory molecules. IL36 gamma is associated with the IL-1 signaling pathway alongside other cytokines such as IL-1 and IL-18 which all contribute to immune modulation and inflammatory responses.

IL36 gamma has connections to psoriasis and inflammatory bowel disease. In psoriasis increased levels of IL36 gamma correlate with heightened skin inflammation and proliferation of keratinocytes. In inflammatory bowel disease IL36 gamma contributes to the inflammatory state of the gut. The activities of IL36 gamma often link with other cytokines such as TNF-alpha which collectively drive the inflammatory processes observed in these conditions.

Specifications

Form

Lyophilized

General info

Function

Functions as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP (By similarity). Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4(+) T-cells and splenocytes.

Sequence similarities

Belongs to the IL-1 family.

Post-translational modifications

N-terminal truncation leads to a dramatic enhancement of its activity (>1000-fold) (PubMed:21965679). Proteolytically cleaved by cathepsin CTSG (By similarity).

Product protocols

Target data

Functions as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP (By similarity). Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in pro-inflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4(+) T-cells and splenocytes.
See full target information Il36g

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com