JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB277024

Recombinant Mouse ILT-3 protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse ILT-3 protein (Fc Chimera) is a Mouse Fragment protein, in the 1 to 238 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD85k, Gp49b, Lilrb4a, Leukocyte immunoglobulin-like receptor subfamily B member 4A, Mast cell surface glycoprotein Gp49B

1 Images
SDS-PAGE - Recombinant Mouse ILT-3 protein (Fc Chimera) (AB277024)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse ILT-3 protein (Fc Chimera) (AB277024)

SDS-PAGE analysis of ab277024

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q64281

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK","proteinLength":"Fragment","predictedMolecularWeight":"50.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":238,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q64281","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ILT-3 also known as Immunoglobulin-like transcript 3 is a protein predominantly expressed on dendritic cells and monocytes. It is a type I transmembrane protein belonging to the leukocyte immunoglobulin-like receptor family. The ILT-3 protein has a molecular mass of approximately 60 kDa. In addition to its presence on dendritic cells and monocytes ILT-3 can be detected in low levels on some types of macrophages. It plays a regulatory role in the immune system which can influence how the body responds to pathogens and tissue damage.
Biological function summary

ILT-3 acts as an inhibitory receptor that modulates immune responses. It is often linked with the control of T cell activation and the maintenance of immune tolerance. ILT-3 does not form part of a larger protein complex. Its inhibitory function helps in preventing overactivation of the immune system by modulating the signaling pathways necessary for immune response. This modulation occurs through ITIM (Immunoreceptor Tyrosine-based Inhibitory Motif) domains that recruit phosphatases helping in dephosphorylating key signaling proteins and aiding in downregulation of immune cell activities.

Pathways

The ILT-3 protein is involved in important immune regulatory pathways contributing significantly to the immune checkpoint pathway. It interacts with other immunoglobulin-like receptors and is known to influence pathways involving PD-1 (Programmed cell death protein 1) and CTLA-4 (Cytotoxic T-lymphocyte-associated protein 4). By affecting these pathways ILT-3 serves as a checkpoint that ensures immune homeostasis prevents excess inflammation and influences the balance between immune activation and suppression within the body.

ILT-3 has been implicated in autoimmune diseases and transplant rejection. It helps in suppressing immune responses that can lead to conditions like rheumatoid arthritis and could negatively affect organ transplant outcomes by minimizing the chance of rejection. ILT-3's role in these conditions connects it to proteins such as HLA-G and PD-L1 which are also involved in immune modulation and contribute to disease pathogenesis. Understanding ILT-3’s role provides insights into potential therapeutic targets for these diseases.

Specifications

Form

Lyophilized

General info

Function

Inhibitory receptor involved in the down-regulation of the immune response (PubMed : 10026201, PubMed : 24935931). Receptor for FN1 (PubMed : 34089617). Receptor for integrin ITGAV/ITGB3 (PubMed : 11323698). Inhibits IgE-mediated mast cell activation, at least in part through interaction with ITGAV/ITGB3 (PubMed : 10026201, PubMed : 11323698, PubMed : 11457897, PubMed : 8855262). Also inhibits KITLG/SCF-mediated mast cell activation (PubMed : 12884301). Through interaction with ITGAV/ITGB3, inhibits antibody production by memory and marginal zone B cells, probably by suppressing their differentiation into plasma cells (PubMed : 24935931). Inhibits IFNG production by CD8 T cells, CD4 T cells and natural killer cells (PubMed : 12682239). Inhibits antigen presentation by dendritic cells to T cells, preventing T cell activation (PubMed : 18792399). Inhibits lipopolysaccharide-mediated neutrophil-dependent vascular injury (PubMed : 14557414). Suppresses the allergic inflammatory response by inhibiting infiltration of neutrophils and eosinophils and preventing mast cell degranulation (PubMed : 17761953). Inhibits lysis by natural killer cells (PubMed : 8977169).

Post-translational modifications

Tyrosine phosphorylated.

Product protocols

Target data

Inhibitory receptor involved in the down-regulation of the immune response (PubMed : 10026201, PubMed : 24935931). Receptor for FN1 (PubMed : 34089617). Receptor for integrin ITGAV/ITGB3 (PubMed : 11323698). Inhibits IgE-mediated mast cell activation, at least in part through interaction with ITGAV/ITGB3 (PubMed : 10026201, PubMed : 11323698, PubMed : 11457897, PubMed : 8855262). Also inhibits KITLG/SCF-mediated mast cell activation (PubMed : 12884301). Through interaction with ITGAV/ITGB3, inhibits antibody production by memory and marginal zone B cells, probably by suppressing their differentiation into plasma cells (PubMed : 24935931). Inhibits IFNG production by CD8 T cells, CD4 T cells and natural killer cells (PubMed : 12682239). Inhibits antigen presentation by dendritic cells to T cells, preventing T cell activation (PubMed : 18792399). Inhibits lipopolysaccharide-mediated neutrophil-dependent vascular injury (PubMed : 14557414). Suppresses the allergic inflammatory response by inhibiting infiltration of neutrophils and eosinophils and preventing mast cell degranulation (PubMed : 17761953). Inhibits lysis by natural killer cells (PubMed : 8977169).
See full target information Lilrb4a

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com