JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259378

Recombinant mouse Interferon gamma protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant mouse Interferon gamma protein (Active) is a Mouse Full Length protein, in the 20 to 155 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

Interferon gamma, IFN-gamma, Ifng

4 Images
Functional Studies - Recombinant mouse Interferon gamma protein (Active) (AB259378)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse Interferon gamma protein (Active) (AB259378)

Fully biologically active determined by the dose dependent reduction in the cytopathic effect of viral infection of L929 cells.

ED50 for this effect is 1.66 ng/ml corresponding to a specific activity of 0.602 x 106 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3372560-1

Mass Spectrometry - Recombinant mouse Interferon gamma protein (Active) (AB259378)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse Interferon gamma protein (Active) (AB259378)

Mass determination by ESI TOF.

Predicted mass is 15948.66 Da (+/- 10Da by ESI TOF). Observed mass is 15949.73 Da

HPLC - Recombinant mouse Interferon gamma protein (Active) (AB259378)
  • HPLC

Supplier Data

HPLC - Recombinant mouse Interferon gamma protein (Active) (AB259378)

HPLC analysis of ab259378.

SDS-PAGE - Recombinant mouse Interferon gamma protein (Active) (AB259378)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse Interferon gamma protein (Active) (AB259378)

SDS-PAGE analysis of ab259378.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, HPLC, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent reduction in the cytopathic effect of viral infection of L929 cells.

ED50 for this effect is 1.66 ng/ml corresponding to a specific activity of 0.602 x 106 units/mg.

Accession

P01580

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"CYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC","proteinLength":"Full Length","predictedMolecularWeight":"15.95 kDa","actualMolecularWeight":"15.95 kDa","aminoAcidEnd":155,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01580","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Interferon gamma (IFN-γ) also known as type II interferon is a cytokine that plays an important role in immune response. IFN-γ has a molecular weight of about 17 kDa and is produced by T cells and natural killer (NK) cells. IFN-γ binds to the interferon gamma receptor initiating a signaling cascade that activates various genes involved in immune functions. It is expressed mainly in activated immune cells within lymphoid tissues and inflamed sites during immune responses.
Biological function summary

This cytokine is significant in promoting macrophage activation enhancing the antigen presentation process and boosting the antimicrobial activity of phagocytes. IFN-γ is not part of a larger protein complex but works as a homodimer in signal transduction. Its production heightens the Th1 immune response by stimulating the differentiation of naïve T cells into Th1 cells which is essential for effective cellular immunity.

Pathways

IFN-γ is integrally involved in the JAK-STAT signaling pathway alongside another critical cytokine Interleukin-12. This pathway further amplifies the immune response by regulating the expression of genes associated with cellular defense mechanisms. IFN-γ also interacts with the NF-kB pathway influencing inflammation and the activation of further immune responses. These interactions show a network of cooperativity with proteins like STAT1 and NF-kB essential for executing its biological roles.

IFN-γ is linked to autoimmune diseases such as rheumatoid arthritis and multiple sclerosis where its elevated levels can exacerbate inflammatory processes. It connects to other proteins like TNF-alpha in promoting the inflammatory cascade. Moreover lower levels of IFN-γ are associated with a heightened risk of infections like tuberculosis demonstrating its vital role in pathogen defense. Therefore understanding IFN-γ and its interactions can be key in developing therapeutic approaches against these conditions.

Specifications

Form

Lyophilized

Additional notes

=95%  by HPLC

General info

Function

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed : 11585387, PubMed : 8456301). Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL (By similarity). Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation (PubMed : 20535209, PubMed : 25078851).

Sequence similarities

Belongs to the type II (or gamma) interferon family.

Product protocols

Target data

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed : 11585387, PubMed : 8456301). Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL (By similarity). Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation (PubMed : 20535209, PubMed : 25078851).
See full target information Ifng

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Experimental & molecular medicine 57:249-263 PubMed39843977

2025

IFN-γ reprograms cardiac microvascular endothelial cells to mediate doxorubicin transport and influences the sensitivity of mice to doxorubicin-induced cardiotoxicity.

Applications

Unspecified application

Species

Unspecified reactive species

Haoyu Ji,Wenya Ma,Xu Liu,Hongyang Chen,Yining Liu,Zhongyu Ren,Daohong Yin,Ao Cai,Zizhen Zhang,Xin Wang,Wei Huang,Leping Shi,Yanan Tian,Yang Yu,Xiuxiu Wang,Yang Li,Yu Liu,Benzhi Cai
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com