JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB9922

Recombinant mouse Interferon gamma protein (Active)

5

(1 Review)

|

(13 Publications)

Recombinant mouse Interferon gamma protein (Active) is a Mouse Full Length protein, in the 23 to 155 aa range, expressed in Escherichia coli, with >98%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, HPLC.

View Alternative Names

Interferon gamma, IFN-gamma, Ifng

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, HPLC, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Determined by its ability to inhibit the proliferation of murine WEHI-279 cells.

The expected ED50 is ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5 x 106 units/mg.

Accession

P01580

Animal free

No

Carrier free

No

Species

Mouse

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC","proteinLength":"Full Length","predictedMolecularWeight":"15.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":155,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01580","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Interferon gamma (IFN-γ) also known as type II interferon is a cytokine that plays an important role in immune response. IFN-γ has a molecular weight of about 17 kDa and is produced by T cells and natural killer (NK) cells. IFN-γ binds to the interferon gamma receptor initiating a signaling cascade that activates various genes involved in immune functions. It is expressed mainly in activated immune cells within lymphoid tissues and inflamed sites during immune responses.
Biological function summary

This cytokine is significant in promoting macrophage activation enhancing the antigen presentation process and boosting the antimicrobial activity of phagocytes. IFN-γ is not part of a larger protein complex but works as a homodimer in signal transduction. Its production heightens the Th1 immune response by stimulating the differentiation of naïve T cells into Th1 cells which is essential for effective cellular immunity.

Pathways

IFN-γ is integrally involved in the JAK-STAT signaling pathway alongside another critical cytokine Interleukin-12. This pathway further amplifies the immune response by regulating the expression of genes associated with cellular defense mechanisms. IFN-γ also interacts with the NF-kB pathway influencing inflammation and the activation of further immune responses. These interactions show a network of cooperativity with proteins like STAT1 and NF-kB essential for executing its biological roles.

IFN-γ is linked to autoimmune diseases such as rheumatoid arthritis and multiple sclerosis where its elevated levels can exacerbate inflammatory processes. It connects to other proteins like TNF-alpha in promoting the inflammatory cascade. Moreover lower levels of IFN-γ are associated with a heightened risk of infections like tuberculosis demonstrating its vital role in pathogen defense. Therefore understanding IFN-γ and its interactions can be key in developing therapeutic approaches against these conditions.

Specifications

Form

Lyophilized

Additional notes

>= HPLC analyses.Sterile filtered.

General info

Function

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed : 11585387, PubMed : 8456301). Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL (By similarity). Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation (PubMed : 20535209, PubMed : 25078851).

Sequence similarities

Belongs to the type II (or gamma) interferon family.

Product protocols

Target data

Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (PubMed : 11585387, PubMed : 8456301). Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL (By similarity). Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation (PubMed : 20535209, PubMed : 25078851).
See full target information Ifng

Publications (13)

Recent publications for all applications. Explore the full list and refine your search

Journal of cachexia, sarcopenia and muscle 16:e13776 PubMed40183240

2025

Calcium Handling Machinery and Sarcomere Assembly are Impaired Through Multipronged Mechanisms in Cancer Cytokine-Induced Cachexia.

Applications

Unspecified application

Species

Unspecified reactive species

Luis Vincens Gand,Chiara Lanzuolo,Mugeng Li,Valentina Rosti,Natalie Weber,Dongchao Lu,Christian Bär,Thomas Thum,Andreas Pich,Theresia Kraft,Mamta Amrute-Nayak,Arnab Nayak

Molecular therapy. Oncology 32:200783 PubMed38595983

2024

Conditionally replicative adenovirus as a therapy for malignant peripheral nerve sheath tumors.

Applications

Unspecified application

Species

Unspecified reactive species

Julia A Nikrad,Robert T Galvin,Mackenzie M Sheehy,Ethan L Novacek,Kari L Jacobsen,Stanislas M A S Corbière,Pauline J Beckmann,Tyler A Jubenville,Masato Yamamoto,David A Largaespada

Cancer immunology research 12:575-591 PubMed38588410

2024

PVRL2 Suppresses Antitumor Immunity through PVRIG- and TIGIT-independent Pathways.

Applications

Unspecified application

Species

Unspecified reactive species

Jiuling Yang,Li Wang,James R Byrnes,Lisa L Kirkemo,Hannah Driks,Cassandra D Belair,Oscar A Aguilar,Lewis L Lanier,James A Wells,Lawrence Fong,Robert Blelloch

Nature 619:632-639 PubMed37344599

2023

Histone demethylase KDM5D upregulation drives sex differences in colon cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Jiexi Li,Zhengdao Lan,Wenting Liao,James W Horner,Xueping Xu,Jielin Liu,Yohei Yoshihama,Shan Jiang,Hong Seok Shim,Max Slotnik,Kyle A LaBella,Chang-Jiun Wu,Kenneth Dunner,Wen-Hao Hsu,Rumi Lee,Isha Khanduri,Christopher Terranova,Kadir Akdemir,Deepavali Chakravarti,Xiaoying Shang,Denise J Spring,Y Alan Wang,Ronald A DePinho

Nature communications 13:6539 PubMed36344500

2022

DNA barcoding reveals ongoing immunoediting of clonal cancer populations during metastatic progression and immunotherapy response.

Applications

Unspecified application

Species

Unspecified reactive species

Louise A Baldwin,Nenad Bartonicek,Jessica Yang,Sunny Z Wu,Niantao Deng,Daniel L Roden,Chia-Ling Chan,Ghamdan Al-Eryani,Damien J Zanker,Belinda S Parker,Alexander Swarbrick,Simon Junankar

Clinical cancer research : an official journal of the American Association for Cancer Research 28:4551-4564 PubMed35920742

2022

Inhibition of LSD1 with Bomedemstat Sensitizes Small Cell Lung Cancer to Immune Checkpoint Blockade and T-Cell Killing.

Applications

Unspecified application

Species

Unspecified reactive species

Joseph B Hiatt,Holly Sandborg,Sarah M Garrison,Henry U Arnold,Sheng-You Liao,Justin P Norton,Travis J Friesen,Feinan Wu,Kate D Sutherland,Hugh Y Rienhoff,Renato Martins,A McGarry Houghton,Shivani Srivastava,David MacPherson

Cancer cell 39:54-67.e9 PubMed33385331

2021

Integrin αvβ6-TGFβ-SOX4 Pathway Drives Immune Evasion in Triple-Negative Breast Cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Archis Bagati,Sushil Kumar,Peng Jiang,Jason Pyrdol,Angela E Zou,Anze Godicelj,Nathan D Mathewson,Adam N R Cartwright,Paloma Cejas,Myles Brown,Anita Giobbie-Hurder,Deborah Dillon,Judith Agudo,Elizabeth A Mittendorf,X Shirley Liu,Kai W Wucherpfennig

Journal for immunotherapy of cancer 8: PubMed32581055

2020

IL-6 promotes PD-L1 expression in monocytes and macrophages by decreasing protein tyrosine phosphatase receptor type O expression in human hepatocellular carcinoma.

Applications

Unspecified application

Species

Unspecified reactive species

Wenjie Zhang,Yang Liu,Zhongyi Yan,Hui Yang,Wei Sun,Yongliang Yao,Yun Chen,Runqiu Jiang

Molecular therapy : the journal of the American So 28:2007-2022 PubMed32531238

2020

Macrophage Subpopulation Dynamics Shift following Intravenous Infusion of Mesenchymal Stromal Cells.

Applications

Unspecified application

Species

Unspecified reactive species

Nina Kosaric,Waracharee Srifa,Clark A Bonham,Harriet Kiwanuka,Kellen Chen,Britta A Kuehlmann,Zeshaan N Maan,Chikage Noishiki,Matthew H Porteus,Michael T Longaker,Geoffrey C Gurtner

The Journal of biological chemistry 295:8036-8047 PubMed32354743

2020

Guanylate-binding protein 2 orchestrates innate immune responses against murine norovirus and is antagonized by the viral protein NS7.

Applications

Unspecified application

Species

Unspecified reactive species

Peifa Yu,Yang Li,Yunlong Li,Zhijiang Miao,Maikel P Peppelenbosch,Qiuwei Pan
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com