JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB222365

Recombinant Mouse Leptin Precursor protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Leptin Precursor protein is a Mouse Full Length protein, in the 22 to 167 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Ob, Lep, Leptin, Obesity factor

1 Images
SDS-PAGE - Recombinant Mouse Leptin Precursor protein (AB222365)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Mouse Leptin Precursor protein (AB222365)

SDS PAGE analysis of ab222365 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P41160

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute at 0.1 mg/mL in 20 mM HCl

Storage buffer

Constituents: Mannitol, 0.1% Trifluoroacetic acid

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC","proteinLength":"Full Length","predictedMolecularWeight":"16.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":167,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P41160","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The leptin precursor also known as OB protein is a 16 kDa hormone primarily involved in the regulation of energy balance. It plays a major role in suppressing appetite and increasing energy expenditure. Leptin is secreted by adipocytes or fat cells in response to fat storage levels and circulates through the bloodstream to exert its effects. The gene encoding leptin LEP is expressed highly in adipose tissue but also shows expression in the stomach placenta and other tissues.
Biological function summary

Leptin influences several processes in the body including appetite control metabolism and reproductive functions. It acts by binding to leptin receptors which are part of the cytokine receptor family. Leptin signaling forms a network of neuroendocrine interactions where it signal to the hypothalamus in the brain to regulate food intake and energy expenditure. This hormone functions as an important determinant of satiety and body weight maintenance while also playing a role in various reproductive and immune system processes given its presence in a complex involving multiple signaling pathways.

Pathways

Leptin is integral to the JAK-STAT signaling pathway and PI3K/AKT pathway which are critical in modulating metabolic processes. In the JAK-STAT pathway leptin binds to its receptor leading to the activation of JAK kinases and subsequent phosphorylation of STAT proteins altering gene expression. Through these pathways leptin interacts with proteins like SOCS3 and PI3 kinase influencing energy metabolism and insulin sensitivity. Its interaction with these proteins substantiates leptin’s role in controlling energy homeostasis and glucose regulation.

Leptin levels and signaling have been linked to obesity and metabolic disorders such as type 2 diabetes. Leptin resistance occurs in obesity where high levels of leptin fail to suppress appetite due to signaling defects contributing to excessive weight gain. Furthermore altered leptin signaling has associations with reproductive disorders as it influences the hypothalamic-pituitary-gonadal axis regulating reproductive health. Correlations with proteins such as insulin receptor substrate 2 exhibit leptin’s close ties to metabolic dysfunction and endocrine-associated disorders.

Specifications

Form

Lyophilized

General info

Function

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways (PubMed : 11373681, PubMed : 12594516, PubMed : 15899045, PubMed : 16825198, PubMed : 20620997). In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic for endothelial cell and affects innate and adaptive immunity (By similarity) (PubMed : 10660043, PubMed : 12594516, PubMed : 25060689, PubMed : 25383904, PubMed : 8589726, PubMed : 9732873). In the arcuate nucleus of the hypothalamus, activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequent reduction on release of orexigenic peptides (By similarity) (PubMed : 11373681, PubMed : 20620997). In addition to its known satiety inducing effect, has a modulatory role in nutrient absorption. In the intestine, reduces glucose absorption by enterocytes by activating PKC and leading to a sequential activation of p38, PI3K and ERK signaling pathways which exerts an inhibitory effect on glucose absorption. Acts as a growth factor on certain tissues, through the activation of different signaling pathways increases expression of genes involved in cell cycle regulation such as CCND1, via JAK2-STAT3 pathway, or VEGFA, via MAPK1/3 and PI3K-AKT1 pathways (By similarity) (PubMed : 16825198, PubMed : 20620997). May also play an apoptotic role via JAK2-STAT3 pathway and up-regulation of BIRC5 expression (By similarity). Pro-angiogenic, has mitogenic activity on vascular endothelial cells and plays a role in matrix remodeling by regulating the expression of matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) (PubMed : 16825198). In innate immunity, modulates the activity and function of neutrophils by increasing chemotaxis and the secretion of oxygen radicals. Increases phagocytosis by macrophages and enhances secretion of pro-inflammatory mediators. Increases cytotoxic ability of NK cells (Probable). Plays a pro-inflammatory role, in synergy with IL1B, by inducing NOS2 which promotes the production of IL6, IL8 and Prostaglandin E2, through a signaling pathway that involves JAK2, PI3K, MAP2K1/MEK1 and MAPK14/p38 (PubMed : 15899045). In adaptive immunity, promotes the switch of memory T-cells towards T helper-1 cell immune responses (By similarity). Increases CD4(+)CD25(-) T cells proliferation and reduces autophagy during TCR (T cell receptor) stimulation, through MTOR signaling pathway activation and BCL2 up-regulation (PubMed : 25060689).

Sequence similarities

Belongs to the leptin family.

Product protocols

Target data

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways (PubMed : 11373681, PubMed : 12594516, PubMed : 15899045, PubMed : 16825198, PubMed : 20620997). In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic for endothelial cell and affects innate and adaptive immunity (By similarity) (PubMed : 10660043, PubMed : 12594516, PubMed : 25060689, PubMed : 25383904, PubMed : 8589726, PubMed : 9732873). In the arcuate nucleus of the hypothalamus, activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequent reduction on release of orexigenic peptides (By similarity) (PubMed : 11373681, PubMed : 20620997). In addition to its known satiety inducing effect, has a modulatory role in nutrient absorption. In the intestine, reduces glucose absorption by enterocytes by activating PKC and leading to a sequential activation of p38, PI3K and ERK signaling pathways which exerts an inhibitory effect on glucose absorption. Acts as a growth factor on certain tissues, through the activation of different signaling pathways increases expression of genes involved in cell cycle regulation such as CCND1, via JAK2-STAT3 pathway, or VEGFA, via MAPK1/3 and PI3K-AKT1 pathways (By similarity) (PubMed : 16825198, PubMed : 20620997). May also play an apoptotic role via JAK2-STAT3 pathway and up-regulation of BIRC5 expression (By similarity). Pro-angiogenic, has mitogenic activity on vascular endothelial cells and plays a role in matrix remodeling by regulating the expression of matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) (PubMed : 16825198). In innate immunity, modulates the activity and function of neutrophils by increasing chemotaxis and the secretion of oxygen radicals. Increases phagocytosis by macrophages and enhances secretion of pro-inflammatory mediators. Increases cytotoxic ability of NK cells (Probable). Plays a pro-inflammatory role, in synergy with IL1B, by inducing NOS2 which promotes the production of IL6, IL8 and Prostaglandin E2, through a signaling pathway that involves JAK2, PI3K, MAP2K1/MEK1 and MAPK14/p38 (PubMed : 15899045). In adaptive immunity, promotes the switch of memory T-cells towards T helper-1 cell immune responses (By similarity). Increases CD4(+)CD25(-) T cells proliferation and reduces autophagy during TCR (T cell receptor) stimulation, through MTOR signaling pathway activation and BCL2 up-regulation (PubMed : 25060689).
See full target information Lep

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com