JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB226884

Recombinant Mouse Liver Arginase protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Liver Arginase protein (His tag) is a Mouse Full Length protein, in the 1 to 323 aa range, expressed in Yeast, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Arginase-1, Liver-type arginase, Type I arginase, Arg1

3 Images
Mass Spectrometry - Recombinant Mouse Liver Arginase protein (His tag) (AB226884)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse Liver Arginase protein (His tag) (AB226884)

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab226884 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Liver Arginase.

Mass Spectrometry - Recombinant Mouse Liver Arginase protein (His tag) (AB226884)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse Liver Arginase protein (His tag) (AB226884)

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab226884 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Liver Arginase.

SDS-PAGE - Recombinant Mouse Liver Arginase protein (His tag) (AB226884)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Liver Arginase protein (His tag) (AB226884)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226884 with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Yeast

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q61176

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK","proteinLength":"Full Length","predictedMolecularWeight":"36.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":323,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Yeast","accessionNumber":"Q61176","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.. Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (By similarity). In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (PubMed : 27043409). Plays a role in the immune response of alternatively activated or M2 macrophages in processes such as wound healing and tissue regeneration, immune defense against multicellular pathogens and parasites, and immune suppression and allergic inflammation; the regulatory outcome seems to be organ specific (PubMed : 19360123, PubMed : 20483789, PubMed : 23552798, PubMed : 23637937, PubMed : 7537672). In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs) plays a role in suppression of T cell-mediated antitumor immunity (PubMed : 19414774, PubMed : 23248265).

Sequence similarities

Belongs to the arginase family.

Product protocols

Target data

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.. Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (By similarity). In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (PubMed : 27043409). Plays a role in the immune response of alternatively activated or M2 macrophages in processes such as wound healing and tissue regeneration, immune defense against multicellular pathogens and parasites, and immune suppression and allergic inflammation; the regulatory outcome seems to be organ specific (PubMed : 19360123, PubMed : 20483789, PubMed : 23552798, PubMed : 23637937, PubMed : 7537672). In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs) plays a role in suppression of T cell-mediated antitumor immunity (PubMed : 19414774, PubMed : 23248265).
See full target information Arg1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com