JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB238240

Recombinant Mouse LY6E/SCA-2 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse LY6E/SCA-2 protein (Tagged) is a Mouse Full Length protein, in the 21 to 102 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Ly67, Sca-2, Tsa-1, Ly6e, Lymphocyte antigen 6E, Ly-6E, Stem cell antigen 2, Thymic shared antigen 1, TSA-1

1 Images
SDS-PAGE - Recombinant Mouse LY6E/SCA-2 protein (Tagged) (AB238240)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse LY6E/SCA-2 protein (Tagged) (AB238240)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238240.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q64253

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Protein previously known as LY6E.

Sequence info

[{"sequence":"LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA","proteinLength":"Full Length","predictedMolecularWeight":"22.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":102,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q64253","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

LY6E also known as SCA-2 is a membrane protein known for its role in immune response. With a mass of approximately 15 kDa LY6E is expressed on the cell surface in various tissues including the immune system and some epithelial cells. The protein belongs to the LY6 family which is characterized by the presence of a Ly6/uPAR domain playing a part in cellular signaling and host defense mechanisms.
Biological function summary

LY6E has a significant impact on immune modulation and viral infection processes. It interacts with other immune-related proteins and contributes to the regulation of T-cell proliferation and differentiation. While LY6E is not a part of a multi-protein complex itself its activity can modify the function of immune cells and potentially alter immune responses. This makes it an important player in the context of both adaptive and innate immunity.

Pathways

LY6E participates in key immune signaling pathways particularly those related to interferon signaling and antiviral defense. It influences these pathways by interacting with components such as interferon-gamma and other cytokines which regulate immune cell behavior and response. LY6E affects the STAT pathway by indirectly modulating the activity of STAT1 a critical protein in immune response highlighting its importance in orchestrating immune dynamics.

LY6E has been implicated in several viral infections and cancers. Its expression alters during viral infections such as influenza and HIV where it may play a role in enhancing or suppressing viral replication. LY6E's interaction with other proteins like STAT1 and various viral envelope proteins could contribute to immune escape or disease progression. Moreover aberrant regulation of LY6E levels has connections with cancer progression affecting tumor immunity and potentially making it a target for therapeutic interventions.

Specifications

Form

Liquid

General info

Function

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation (PubMed : 8642345, PubMed : 9575182). Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation (PubMed : 9575182). Restricts the entry of murine coronavirus, mouse hepatitis virus, by interfering with spike protein-mediated membrane fusion (PubMed : 32704094). Also plays an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA) (PubMed : 28679758). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta (PubMed : 29500366). May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3 : beta-4-containing nAChRs maximum response (PubMed : 26276394).

Product protocols

Target data

GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation (PubMed : 8642345, PubMed : 9575182). Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation (PubMed : 9575182). Restricts the entry of murine coronavirus, mouse hepatitis virus, by interfering with spike protein-mediated membrane fusion (PubMed : 32704094). Also plays an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA) (PubMed : 28679758). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta (PubMed : 29500366). May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3 : beta-4-containing nAChRs maximum response (PubMed : 26276394).
See full target information Ly6e

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com