JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235821

Recombinant Mouse Myoglobin protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Myoglobin protein (Tagged) is a Mouse Full Length protein, in the 2 to 154 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Myoglobin, Nitrite reductase MB, Pseudoperoxidase MB, Mb

3 Images
Mass Spectrometry - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235821 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mb.

Mass Spectrometry - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235821 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mb.

SDS-PAGE - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Myoglobin protein (Tagged) (AB235821)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5%wnrichment gel and 15% separation gel of ab235821.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P04247

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG","proteinLength":"Full Length","predictedMolecularWeight":"21.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":154,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P04247","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Myoglobin also known as MB is a small globular protein with a molecular weight of approximately 17 kDa. It functions as an oxygen-binding protein and is expressed mainly in cardiac and skeletal muscle tissue where it facilitates oxygen storage and transport. The myoglobin protein plays an important role in maintaining the oxygen supply needed during muscular contraction and intense physical activity.
Biological function summary

Myoglobin in muscle cells acts to store oxygen which provides a rapid release when required during muscle contraction. Myoglobin serves as a monomer and does not form part of a complex. Its structure allows it to temporarily store and relay oxygen where it is most required enhancing the often abrupt demands of muscles for oxygen. The ability of myoglobin to bind oxygen and release it under hypoxic conditions is central to its biological role in vertebrates.

Pathways

The function of myoglobin in aerobic respiration in muscles involves its participation in the oxygen transport pathway. This protein closely interacts with hemoglobin to mobilize oxygen effectively to mitochondria during muscle contraction. Unlike hemoglobin myoglobin has a hyperbolic oxygen dissociation curve which allows it to provide oxygen at lower partial pressures contributing significantly to the efficient metabolism during hypoxia or intense muscular exertion.

Myoglobin plays a significant role in conditions such as rhabdomyolysis and myocardial infarction. Rhabdomyolysis a syndrome caused by muscle injury results in the release of myoglobin into the bloodstream. Myoglobin detection kits including myoglobin ELISA are essential tools for the diagnosis of these conditions. Moreover its rapid increase in plasma levels after heart muscle damage enables its use as an early marker for myocardial infarction. Myoglobin's interaction with proteins like creatine kinase provides valuable information on muscle damage and cardiac events.

Specifications

Form

Liquid

General info

Function

Monomeric heme protein which primary function is to store oxygen and facilitate its diffusion within muscle tissues. Reversibly binds oxygen through a pentacoordinated heme iron and enables its timely and efficient release as needed during periods of heightened demand (PubMed : 10468637, PubMed : 11304494). Depending on the oxidative conditions of tissues and cells, and in addition to its ability to bind oxygen, it also has a nitrite reductase activity whereby it regulates the production of bioactive nitric oxide (By similarity). Under stress conditions, like hypoxia and anoxia, it also protects cells against reactive oxygen species thanks to its pseudoperoxidase activity (PubMed : 15132981).

Sequence similarities

Belongs to the globin family.

Product protocols

Target data

Monomeric heme protein which primary function is to store oxygen and facilitate its diffusion within muscle tissues. Reversibly binds oxygen through a pentacoordinated heme iron and enables its timely and efficient release as needed during periods of heightened demand (PubMed : 10468637, PubMed : 11304494). Depending on the oxidative conditions of tissues and cells, and in addition to its ability to bind oxygen, it also has a nitrite reductase activity whereby it regulates the production of bioactive nitric oxide (By similarity). Under stress conditions, like hypoxia and anoxia, it also protects cells against reactive oxygen species thanks to its pseudoperoxidase activity (PubMed : 15132981).
See full target information Mb

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com