JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB222977

Recombinant Mouse Nmnat1/NMNAT protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Nmnat1/NMNAT protein (His tag) is a Mouse Full Length protein, in the 1 to 285 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

D4Cole1e, Nmnat, Nmnat1, Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1, NMN/NaMN adenylyltransferase 1, Nicotinamide mononucleotide adenylyltransferase 1, Nicotinate-nucleotide adenylyltransferase 1, NMN adenylyltransferase 1, NaMN adenylyltransferase 1

1 Images
SDS-PAGE - Recombinant Mouse Nmnat1/NMNAT protein (His tag) (AB222977)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Nmnat1/NMNAT protein (His tag) (AB222977)

15% SDS-PAGE - Recombinant Mouse Nmnat1/NMNAT protein (His tag) (3 μg ab222977).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9EPA7

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS, 20% Glycerol (glycerin, glycerine), 0.03% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Nmnat1

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMDSSKKTEVVLLACGSFNPITNMHLRLFELAKDYMHATGKYSVIKGIISPVGDAYKKKGLIPAHHRIIMAELATKNSHWVEVDTWESLQKEWVETVKVLRYHQEKLATGSCSYPQSSPALEKPGRKRKWADQKQDSSPQKPQEPKPTGVPKVKLLCGITNDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHELYNTESEGRNAGVTLAPLQRNAAEAKHNHSTL","proteinLength":"Full Length","predictedMolecularWeight":"34.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":285,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9EPA7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Nmnat1 also known as nicotinamide mononucleotide adenylyltransferase 1 is an enzyme involved in the conversion of nicotinamide mononucleotide (NMN) to nicotinamide adenine dinucleotide (NAD+). This enzyme weighs approximately 32 kDa and is expressed largely in mammalian tissues with higher concentrations in the brain heart and liver. In the research community variations like 'nmn ireland' or 'elisa namn' may refer to the study tools or location of research related to NMNAT.
Biological function summary

NMNAT1 plays a role in NAD+ biosynthesis which is essential for energy metabolism and cellular functions. It acts as a NAD+ synthase and may not work alone but within larger enzymatic complexes that handle cellular redox reactions. In neurons the enzyme supports axonal survival which connects it to neurodegenerative health studies.

Pathways

This enzyme becomes critical in the NAD+ biosynthesis pathway interacting closely with proteins such as nicotinamide phosphoribosyltransferase (NAMPT) in the salvage pathway. This pathway is key in maintaining cellular energy balance and gene expression regulation. The enzyme along with these related proteins ensures the recycling and regulation of NAD+ within the cells.

NMNAT1 holds significance in conditions like axonopathy and certain retinal degenerations. Mutations in the NMNAT1 gene have been linked to Leber's congenital amaurosis a severe genetic eye disorder. Studies often focus on NMNAT1 alongside other proteins like sirtuins as these participate in mitigating the oxidative stress aspects involved in neurodegeneration and associated disorders.

Specifications

Form

Liquid

Additional notes

ab222977 was purified by using conventional chromatography.

General info

Function

Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP (PubMed : 15381699, PubMed : 27735788). Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency (By similarity). Can use triazofurin monophosphate (TrMP) as substrate (By similarity). Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+) (By similarity). For the pyrophosphorolytic activity, prefers NAD(+) and NaAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively (By similarity). Involved in the synthesis of ATP in the nucleus, together with PARP1, PARG and NUDT5 (By similarity). Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming (By similarity). Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NaADP(+) (By similarity). Also acts as a cofactor for glutamate and aspartate ADP-ribosylation by directing PARP1 catalytic activity to glutamate and aspartate residues on histones (PubMed : 32822587). Protects against axonal degeneration following mechanical or toxic insults (PubMed : 15310905, PubMed : 16914673). Delays axonal degeneration after axotomy. Results in a >10-fold increase in intact neurites 72 hours after injury (PubMed : 16914673, PubMed : 27735788).

Sequence similarities

Belongs to the eukaryotic NMN adenylyltransferase family.

Subcellular localisation

Nucleus

Product protocols

Target data

Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP (PubMed : 15381699, PubMed : 27735788). Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency (By similarity). Can use triazofurin monophosphate (TrMP) as substrate (By similarity). Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+) (By similarity). For the pyrophosphorolytic activity, prefers NAD(+) and NaAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively (By similarity). Involved in the synthesis of ATP in the nucleus, together with PARP1, PARG and NUDT5 (By similarity). Nuclear ATP generation is required for extensive chromatin remodeling events that are energy-consuming (By similarity). Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NaADP(+) (By similarity). Also acts as a cofactor for glutamate and aspartate ADP-ribosylation by directing PARP1 catalytic activity to glutamate and aspartate residues on histones (PubMed : 32822587). Protects against axonal degeneration following mechanical or toxic insults (PubMed : 15310905, PubMed : 16914673). Delays axonal degeneration after axotomy. Results in a >10-fold increase in intact neurites 72 hours after injury (PubMed : 16914673, PubMed : 27735788).
See full target information Nmnat1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com