JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB281818

Recombinant mouse Noggin protein (Active)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant mouse Noggin protein (Active) is a Mouse Full Length protein, in the 28 to 232 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

Noggin, Nog

4 Images
Functional Studies - Recombinant mouse Noggin protein (Active) (AB281818)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse Noggin protein (Active) (AB281818)

Functional analysis of ab281818.

Fully biologically active determined by its ability to inhibit MPB-4 induced alkaline phosphatase activity in ATDC5 cells.

ED50 for this effect is ≤62.22 ng/ml, correspnding to a specific activity of 1.61 x 104 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3385912-1

Mass Spectrometry - Recombinant mouse Noggin protein (Active) (AB281818)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse Noggin protein (Active) (AB281818)

Mass determination by ESI-TOF.

Predicted MW is 23130.69 Da. (+/- 10 Da by ESI-TOF). Observed MW is 23232.79 Da. Additional masses at 23407.95 are due to residual O-glycans.

HPLC - Recombinant mouse Noggin protein (Active) (AB281818)
  • HPLC

Supplier Data

HPLC - Recombinant mouse Noggin protein (Active) (AB281818)

HPLC analysis of ab281818.

SDS-PAGE - Recombinant mouse Noggin protein (Active) (AB281818)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse Noggin protein (Active) (AB281818)

SDS-PAGE analysis of ab281818.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, SDS-PAGE, FuncS, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by its ability to inhibit MPB-4 induced alkaline phosphatase activity in ATDC5 cells.

ED50 for this effect is ≤62.22 ng/ml, correspnding to a specific activity of 1.61 x 104 units/mg.

Accession

P97466

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC","proteinLength":"Full Length","predictedMolecularWeight":"23 kDa","actualMolecularWeight":"23.23 kDa","aminoAcidEnd":232,"aminoAcidStart":28,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P97466","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Noggin also known as noggin protein is a secreted glycoprotein with a mass of approximately 26 kDa. It antagonizes bone morphogenetic proteins (BMPs) by directly binding them preventing their interaction with receptors. This binding inhibits the signaling pathway which affects cellular processes such as differentiation growth and apoptosis. Noggin expresses prominently in embryonic tissues and in tissues undergoing differentiation particularly in the neural tube notochord and developing articular cartilage. The expression pattern suggests its importance during critical phases of development and tissue patterning.
Biological function summary

Noggin functions as an essential regulator in embryonic development sculpting tissues by inhibiting BMP activity. It does not work alone but functions as part of a complex regulatory network involving other BMP antagonists. By inhibiting BMPs Noggin plays an important role in neural tube closure limb formation and somite development. Noggin's activities help modulate the balance between proliferation and differentiation in these contexts allowing for proper structural formation during embryogenesis.

Pathways

Noggin operates mainly within the TGF-beta/BMP signaling pathway serving as a critical modulator. Inhibiting BMP through Noggin affects downstream targets connecting it to other signaling proteins like SMADs which mediate transcriptional responses. This control enables Noggin to indirectly regulate Wnt signaling as well showing its impact on various developmental stages and processes. Its influence on these pathways indicates Noggin's importance in maintaining cellular homeostasis during growth and morphogenesis.

Noggin relates to conditions such as fibrodysplasia ossificans progressiva and cartilage-related abnormalities. Mutations or dysregulation of noggin protein can disrupt normal BMP signaling leading to aberrant skeletal development and calcification. This disruption often involves interactions with other proteins like BMP4 revealing Noggin's critical role in maintaining bone and cartilage integrity. Targeting noggin pathway components may provide therapeutic potential for addressing such conditions.

Specifications

Form

Lyophilized

Additional notes

>95% by HPLC

General info

Function

Essential for cartilage morphogenesis and joint formation. Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite (PubMed : 9585504, PubMed : 9603738). Inhibits chondrocyte differentiation through its interaction with GDF5 and, probably, GDF6 (By similarity).

Sequence similarities

Belongs to the noggin family.

Product protocols

Target data

Essential for cartilage morphogenesis and joint formation. Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite (PubMed : 9585504, PubMed : 9603738). Inhibits chondrocyte differentiation through its interaction with GDF5 and, probably, GDF6 (By similarity).
See full target information Nog

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Molecular carcinogenesis 62:1025-1037 PubMed37042566

2023

Translational relevance of SOS1 targeting for KRAS-mutant colorectal cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Diego Alem,Xinrui Yang,Francisca Beato,Bhaswati Sarcar,Alexandra F Tassielli,Ruifan Dai,Tara L Hogenson,Margaret A Park,Kun Jiang,Jianfeng Cai,Yu Yuan,Martin E Fernandez-Zapico,Aik Choon Tan,Jason B Fleming,Hao Xie

Journal of medicinal chemistry 65:16432-16450 PubMed36459180

2022

Development of SOS1 Inhibitor-Based Degraders to Target -Mutant Colorectal Cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Yujia Bian,Diego Alem,Francisca Beato,Tara L Hogenson,Xinrui Yang,Kun Jiang,Jianfeng Cai,Wen Wee Ma,Martin Fernandez-Zapico,Aik Choon Tan,Nicholas J Lawrence,Jason B Fleming,Yu Yuan,Hao Xie
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com