JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB180051

Recombinant mouse PD1 protein (Active)

Be the first to review this product! Submit a review

|

(3 Publications)

Recombinant mouse PD1 protein (Active) is a Mouse Fragment protein, in the 25 to 167 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

CD279, Pd1, Pdcd1, Programmed cell death protein 1, Protein PD-1, mPD-1

2 Images
Functional Studies - Recombinant mouse PD1 protein (Active) (AB180051)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse PD1 protein (Active) (AB180051)

Loaded Mouse PD-L1, Fc Tag on Protein A Biosensor, can bind Mouse PD-1, His Tag (ab180051) with an affinity constant of 6.9 μM as determined in BLI assay (ForteBio Octet Red96e) (Routinely tested).

SDS-PAGE - Recombinant mouse PD1 protein (Active) (AB180051)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse PD1 protein (Active) (AB180051)

Reduced ab180051 on SDS-PAGE, stained overnight with Coomassie Blue.

The protein migrates as 25-45 kDa under reducing condition due to glycosylation.

Purity of protein >90%.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Loaded mouse PD-L1, Fc Tag on Protein A Biosensor, can bind ab180051 with an affinity constant of 6.9 μM as determined in BLI assay.

Accession

Q02242

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

Storage buffer

pH: 7.4 Constituents: PBS, 5% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Protein migrates as 25 - 45 kDa due to different glycosylation.</p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Endotoxin Levels determined by LAL method.

Sequence info

[{"linker":null,"sequence":"LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ","proteinLength":"Fragment","predictedMolecularWeight":"16.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":167,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q02242","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
Up to 12 months
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle|For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA)
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PD1 also known as Programmed Cell Death Protein 1 or PDCD1 is a transmembrane protein that plays a critical role in regulating immune responses. It has a mass of approximately 55 kDa. PD1 is expressed on the surface of T cells B cells and some myeloid cells. PD1’s expression increases upon activation of these immune cells assisting in maintaining peripheral tolerance. Researchers often use PD1 mouse models and chimeric antibodies to explore the function of PD1 for experimental purposes. Antibodies such as anti-PD1 such as EH12.2H7 help in blocking PD1 interaction to study its role further.
Biological function summary

PD1 serves as an inhibitory receptor acting as a checkpoint in the immune system. It becomes part of an immune-suppressive complex when it binds with its ligands PD-L1 or PD-L2 which are expressed on various cell types including some tumor cells. This interaction suppresses the proliferation of T cells and cytokine production contributing to immune homeostasis. By controlling T cell activity PD1 limits autoimmunity but can also reduce the immune system's capability to attack cancer cells.

Pathways

PD1 functions in the immune checkpoint pathway a critical regulatory circuit in immune regulation. The engagement of PD1 with its ligands initiates a cascade that inhibits the function and proliferation of T cells through downstream SHP-2 phosphatase activity. This pathway frequently involves other regulatory proteins like CTLA-4 and is an important mechanism by which the body modulates immune responses. Related pathways often intersect with those involving T cell receptor signaling and contribute to the overall modulation of immune activity.

PD1 has a significant role in cancer and autoimmune disorders. PD1 expression can allow tumors to evade immune surveillance making PD1 a target for cancer therapies such as anti-PD1 antibodies which aim to block PD1 and restore T cell activity. The interaction of PD1 with cancer-related proteins like PD-L1 facilitates tumor immune evasion. In autoimmune disorders PD1’s regulation of immune balance can become dysregulated leading to persistent immune activation and tissue damage. Understanding PD1 and its interaction with proteins such as PD-L1 helps in developing therapeutic strategies for both cancer and autoimmune conditions.

Specifications

Form

Lyophilized

General info

Function

Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self (PubMed : 10485649, PubMed : 11209085, PubMed : 11698646, PubMed : 21300912). Delivers inhibitory signals upon binding to ligands, such as CD274/PDCD1L1 and CD273/PDCD1LG2 (PubMed : 11015443, PubMed : 11224527, PubMed : 18287011, PubMed : 18641123, PubMed : 22641383). Following T-cell receptor (TCR) engagement, PDCD1 associates with TCR-CD3 in the immunological synapse and directly inhibits T-cell activation (PubMed : 22641383). Suppresses T-cell activation through the recruitment of PTPN11/SHP-2 : following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed : 11698646, PubMed : 22641383). The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and facilitate tumor survival (By similarity).

Post-translational modifications

Ubiquitinated at Lys-235 by the SCF(FBXO38) complex, leading to its proteasomal degradation. Ubiquitinated via 'Lys-48'-linked polyubiquitin chains. Deubiquitinated and thus stabilized by USP5.. Tyrosine phosphorylated at Tyr-225 (within ITIM motif) and Tyr-248 (ITSM motif) upon ligand binding (PubMed:11698646, PubMed:22641383). Phosphorylation at Tyr-248 by FYN promotes the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed:22641383). Phosphorylation at Thr-236 promotes the recruitment of the deubiquitinase USP5 (By similarity).

Product protocols

Target data

Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self (PubMed : 10485649, PubMed : 11209085, PubMed : 11698646, PubMed : 21300912). Delivers inhibitory signals upon binding to ligands, such as CD274/PDCD1L1 and CD273/PDCD1LG2 (PubMed : 11015443, PubMed : 11224527, PubMed : 18287011, PubMed : 18641123, PubMed : 22641383). Following T-cell receptor (TCR) engagement, PDCD1 associates with TCR-CD3 in the immunological synapse and directly inhibits T-cell activation (PubMed : 22641383). Suppresses T-cell activation through the recruitment of PTPN11/SHP-2 : following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (PubMed : 11698646, PubMed : 22641383). The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and facilitate tumor survival (By similarity).
See full target information Pdcd1

Publications (3)

Recent publications for all applications. Explore the full list and refine your search

Scientific reports 14:28652 PubMed39562585

2024

Development of selective ssDNA micro-probe for PD1 detection as a novel strategy for cancer imaging.

Applications

Unspecified application

Species

Unspecified reactive species

Stanisław Malicki,Anna Czarna,Edyta Żyła,Barbara Pucelik,Wojciech Gałan,Barbara Chruścicka,Marta Kamińska,Alicja Sochaj-Gregorczyk,Katarzyna Magiera-Mularz,Jun Wang,Marek Winiarski,Małgorzata Benedyk-Machaczka,Joanna Kozieł,Grzegorz Dubin,Piotr Mydel

Brain, behavior, and immunity 106:233-246 PubMed36089217

2022

Neuronally expressed PDL1, not PD1, suppresses acute nociception.

Applications

Unspecified application

Species

Unspecified reactive species

Kimberly A Meerschaert,Brian S Edwards,Ariel Y Epouhe,Bahiyyah Jefferson,Robert Friedman,Olivia L Babyok,Jamie K Moy,Faith Kehinde,Chang Liu,Creg J Workman,Dario A A Vignali,Kathryn M Albers,H Richard Koerber,Michael S Gold,Brian M Davis,Nicole N Scheff,Jami L Saloman

Oncotarget 10:2252-2269 PubMed31040917

2019

PD-L1 checkpoint blockade delivered by retroviral replicating vector confers anti-tumor efficacy in murine tumor models.

Applications

Unspecified application

Species

Unspecified reactive species

Leah A Mitchell,Kader Yagiz,Andrew Hofacre,Sophie Viaud,Anthony W Munday,Fernando Lopez Espinoza,Daniel Mendoza,Maria E Rodriguez-Aguirre,Simon Bergqvist,Ali Haghighi,Marin V Miner,William P Accomando,Cynthia Burrascano,Dawn Gammon,Harry E Gruber,Douglas J Jolly,Amy H Lin
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com