JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307483

Recombinant Mouse PDGF B Protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse PDGF B Protein (Active) is a Mouse Full Length protein, in the 82 to 190 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, Mass Spec, SDS-PAGE, FuncS.

View Alternative Names

Sis, Pdgfb, Platelet-derived growth factor subunit B, PDGF subunit B, PDGF-2, Platelet-derived growth factor B chain, Platelet-derived growth factor beta polypeptide, Proto-oncogene c-Sis

4 Images
Biological Activity - Recombinant Mouse PDGF B Protein (Active) (AB307483)
  • Biological Activity

Lab

Biological Activity - Recombinant Mouse PDGF B Protein (Active) (AB307483)

Fully biologically active determined by the dose dependent proliferation of Balb/c 3T3 cells. ED50 is ≤ 0.49 ng/ml, corresponding to a specific activity of 2.04 x 10^6 units/mg.

Mass Spectrometry - Recombinant Mouse PDGF B Protein (Active) (AB307483)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse PDGF B Protein (Active) (AB307483)

Mass determination by ESI-TOF. Predicted MW is 12280.4 Da (+/-10 Da by ESI-TOF). Observed MW is 12280.44 Da.

SDS-PAGE - Recombinant Mouse PDGF B Protein (Active) (AB307483)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse PDGF B Protein (Active) (AB307483)

SDS-PAGE analysis of ab307483

HPLC - Recombinant Mouse PDGF B Protein (Active) (AB307483)
  • HPLC

Supplier Data

HPLC - Recombinant Mouse PDGF B Protein (Active) (AB307483)

HPLC analysis of ab307483

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, HPLC, SDS-PAGE, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of Balb/c 3T3 cells. ED50 is ≤ 0.49 ng/ml, corresponding to a specific activity of 2.04 x 106 units/mg.

Accession

P31240

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT","proteinLength":"Full Length","predictedMolecularWeight":"12.28 kDa","actualMolecularWeight":"12.28 kDa","aminoAcidEnd":190,"aminoAcidStart":82,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P31240","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

PDGF-B also known as platelet-derived growth factor subunit B or PDGF-BB is a critical protein involved in various cellular processes. Composed of 241 amino acids PDGF-B exhibits a molecular mass of approximately 27 kDa. Scientists recognize this protein for its expression primarily in platelets but it also appears in a range of other tissues including smooth muscle cells and fibroblasts. The PDGF-B protein plays a substantial role in the regulation of growth and division inducing pathways important for cellular proliferation.
Biological function summary

PDGF-B influences cellular signaling processes and facilitates interactions that are a part of the PDGF receptor system. PDGF-B can form a homo-dimerization commonly known as the PDGF-BB dimer which is an active form. When PDGF-B binds to its receptor specifically the PDGF receptor β (PDGFR-β) it triggers pathways that control various cellular activities including growth and survival. The interaction of PDGF-B with the receptor is an important step that modulates several downstream signaling pathways.

Pathways

PDGF-B activates significant pathways such as the MAPK/ERK and PI3K/AKT pathways. These pathways play a major role in the regulation of cell proliferation and differentiation. Through these pathways PDGF-B exhibits interactions with proteins like Ras and Akt which are integral in transmitting signals within the cell. These cascades result in the promotion of processes such as angiogenesis and wound healing highlighting the importance of PDGF-B in cellular function.

Researchers have linked PDGF-B to pathologies such as cancer and atherosclerosis. For instance overexpression of PDGF-B can lead to abnormal vascular growth contributing to tumor development in cancers. It also plays a role in the progression of atherosclerosis by promoting the migration and proliferation of smooth muscle cells leading to plaque formation. In these contexts PDGF-B shows interaction with other proteins such as VEGF in tumor angiogenesis and LDL in atherosclerotic developments reinforcing its involvement in these conditions.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >= 95%

General info

Function

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Product protocols

Target data

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
See full target information Pdgfb

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com