JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235858

Recombinant Mouse PLA2G5 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse PLA2G5 protein (Tagged) is a Mouse Full Length protein, in the 21 to 137 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Phospholipase A2 group V, PLA2-10, Phosphatidylcholine 2-acylhydrolase 5, Pla2g5

1 Images
SDS-PAGE - Recombinant Mouse PLA2G5 protein (Tagged) (AB235858)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse PLA2G5 protein (Tagged) (AB235858)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel using ab235858.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P97391

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Secretory phospholipase A2 Type V

Sequence info

[{"sequence":"GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC","proteinLength":"Full Length","predictedMolecularWeight":"16 kDa","actualMolecularWeight":null,"aminoAcidEnd":137,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P97391","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity), preferentially releasing fatty acyl groups with a low degree of unsaturation such as oleoyl (C18 : 1) and linoleoyl (C18 : 2) groups (PubMed : 14962950). Hydrolyzes low-density lipoprotein (LDL) phospholipids releasing unsaturated fatty acids that drive macrophage polarization toward an M2 phenotype (PubMed : 14962950, PubMed : 24910243). May act in an autocrine and paracrine manner. Contributes to lipid remodeling of cellular membranes at different subcellular locations and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of cardiolipin, a major component of the inner membrane of mitochondria and bacterial membranes (By similarity). Promotes phagocytosis of bacteria in macrophages through production of lysophosphatidylethanolamines (By similarity). Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing the phospholipids of the bacterial membrane (PubMed : 11694541, PubMed : 16407308). Promotes phagocytosis and killing of ingested fungi likely through controlling phagosome-lysosome fusion and phagosome maturation (PubMed : 19342668). Plays a role in biosynthesis of cysteinyl leukotrienes (CysLTs) in myeloid cells (By similarity). In eosinophils, triggers perinuclear arachidonate release and LTC4 synthesis in a PLA2G4A-independent way (By similarity). In neutrophils, amplifies CysLTs biosynthesis initiated by PLA2G4A (By similarity). Promotes immune complex clearance in macrophages via stimulating synthesis of CysLTs, which act through CYSLTR1 to trigger phagocytosis (PubMed : 20432503). May regulate antigen processing in antigen-presenting cells (PubMed : 20817863). In pulmonary macrophages regulates IL33 production required for activation of group 2 innate lymphoid cells (PubMed : 29346348). May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines (By similarity).

Sequence similarities

Belongs to the phospholipase A2 family.

Post-translational modifications

This enzyme lacks one of the seven disulfide bonds found in similar PA2 proteins.

Subcellular localisation

Recycling endosome

Product protocols

Target data

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity), preferentially releasing fatty acyl groups with a low degree of unsaturation such as oleoyl (C18 : 1) and linoleoyl (C18 : 2) groups (PubMed : 14962950). Hydrolyzes low-density lipoprotein (LDL) phospholipids releasing unsaturated fatty acids that drive macrophage polarization toward an M2 phenotype (PubMed : 14962950, PubMed : 24910243). May act in an autocrine and paracrine manner. Contributes to lipid remodeling of cellular membranes at different subcellular locations and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of cardiolipin, a major component of the inner membrane of mitochondria and bacterial membranes (By similarity). Promotes phagocytosis of bacteria in macrophages through production of lysophosphatidylethanolamines (By similarity). Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing the phospholipids of the bacterial membrane (PubMed : 11694541, PubMed : 16407308). Promotes phagocytosis and killing of ingested fungi likely through controlling phagosome-lysosome fusion and phagosome maturation (PubMed : 19342668). Plays a role in biosynthesis of cysteinyl leukotrienes (CysLTs) in myeloid cells (By similarity). In eosinophils, triggers perinuclear arachidonate release and LTC4 synthesis in a PLA2G4A-independent way (By similarity). In neutrophils, amplifies CysLTs biosynthesis initiated by PLA2G4A (By similarity). Promotes immune complex clearance in macrophages via stimulating synthesis of CysLTs, which act through CYSLTR1 to trigger phagocytosis (PubMed : 20432503). May regulate antigen processing in antigen-presenting cells (PubMed : 20817863). In pulmonary macrophages regulates IL33 production required for activation of group 2 innate lymphoid cells (PubMed : 29346348). May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines (By similarity).
See full target information Pla2g5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com