JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB277004

Recombinant Mouse Prostaglandin D Synthase (Lipocalin)/PDS protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Prostaglandin D Synthase (Lipocalin)/PDS protein (His tag) is a Mouse Full Length protein, in the 1 to 189 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Prostaglandin-H2 D-isomerase, Glutathione-independent PGD synthase, Lipocalin-type prostaglandin-D synthase, Prostaglandin-D2 synthase, L-PGDS, PGD2 synthase, PGDS2, Ptgds

1 Images
SDS-PAGE - Recombinant Mouse Prostaglandin D Synthase (Lipocalin)/PDS protein (His tag) (AB277004)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Prostaglandin D Synthase (Lipocalin)/PDS protein (His tag) (AB277004)

SDS-PAGE analysis of ab277004

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O09114

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE","proteinLength":"Full Length","predictedMolecularWeight":"19.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":189,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O09114","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Prostaglandin D Synthase (Lipocalin) also known as PGDS or PDS is an enzyme that catalyzes the conversion of prostaglandin H2 to prostaglandin D2. It plays an important mechanical role in prostaglandin metabolism and has a mass of approximately 20 kDa. This protein is prominently expressed in the central nervous system heart and male genital organs. Its alternate name is lipocalin-type prostaglandin D synthase highlighting its membership in the lipocalin family. Notably it is abundant in cerebrospinal fluid and seminal plasma.
Biological function summary

This protein PDS participates in various physiological processes including inflammation and sleep regulation. It operates independently and is not typically part of larger protein complexes. PGDS contributes to the homeostasis of biological membranes and acts as a neuromodulator in the brain. Its function extends to mediating the actions of the prostaglandin D2 it produces affecting processes like allergic reactions and maintaining normal reproductive physiological functions.

Pathways

PGDS engages with key biological processes by being part of the MAPK signaling pathway and the arachidonic acid cascade. These pathways contribute to inflammation and immune response regulation. PGDS interacts specifically with other proteins along these pathways such as cyclooxygenases (COX-1 COX-2) which are important in the initial creation of prostaglandin H2. Its role in signaling elucidates its involvement in both central and peripheral biological activities.

PGDS links to conditions such as sleep disorders and allergic diseases. The production of prostaglandin D2 by PGDS can exacerbate symptoms of certain allergic responses including asthma. Furthermore PGDS involvement in sleep regulation can relate to narcolepsy. In these conditions it interacts with other proteins involved in prostaglandin signaling such as COX enzymes which are targeted by certain therapeutic interventions.

Specifications

Form

Lyophilized

General info

Function

Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophobic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system (PubMed : 10781097, PubMed : 11751991, PubMed : 12077186, PubMed : 17715133, PubMed : 19546224, PubMed : 19833210, PubMed : 8922532, PubMed : 9892701). Involved in PLA2G3-dependent maturation of mast cells. PLA2G3 is secreted by immature mast cells and acts on nearby fibroblasts upstream to PTDGS to synthesize PGD2, which in turn promotes mast cell maturation and degranulation via PTGDR (PubMed : 23624557).

Sequence similarities

Belongs to the calycin superfamily. Lipocalin family.

Subcellular localisation

Nucleus membrane

Product protocols

Target data

Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophobic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system (PubMed : 10781097, PubMed : 11751991, PubMed : 12077186, PubMed : 17715133, PubMed : 19546224, PubMed : 19833210, PubMed : 8922532, PubMed : 9892701). Involved in PLA2G3-dependent maturation of mast cells. PLA2G3 is secreted by immature mast cells and acts on nearby fibroblasts upstream to PTDGS to synthesize PGD2, which in turn promotes mast cell maturation and degranulation via PTGDR (PubMed : 23624557).
See full target information Ptgds

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com