JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB227388

Recombinant Mouse RALA protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Mouse RALA protein (His tag N-Terminus) is a Mouse Full Length protein, in the 1 to 203 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Ral, Ral-a, Rala, Ras-related protein Ral-A

1 Images
SDS-PAGE - Recombinant Mouse RALA protein (His tag N-Terminus) (AB227388)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse RALA protein (His tag N-Terminus) (AB227388)

15% SDS-PAGE analysis of 3 μg ab227388.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P63321

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 8.5 Constituents: 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERC","proteinLength":"Full Length","predictedMolecularWeight":"25.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":203,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P63321","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RALA also known as Ras-related protein Ral-A or RalA is a small GTPase involved in a variety of cellular processes. It has a molecular mass of approximately 23 kDa. RALA switches between inactive GDP-bound and active GTP-bound states facilitating the transduction of signals within the cell. This protein is found in a range of tissues with expression in the brain lung and kidney being notable. The ability of RALA to shuttle between membrane compartments highlights its mechanical versatility in cellular signaling.
Biological function summary

The interaction of RALA with effector proteins drives key processes like vesicle trafficking cytoskeletal dynamics and gene expression. RALA forms part of a signaling complex in its active state that mediates these functions. This protein is vital in the neurotransmitter release ensuring efficient communication between neurons. Additionally RALA impacts cell movement by influencing actin filament organization showing its role in cell motility.

Pathways

The engagement of RALA in Ral signaling and the phosphatidylinositol 3-kinase (PI3K) pathway showcases its importance. In Ral signaling RALA interacts closely with proteins like RalBP1 influencing endocytosis and exocytosis activities. In the PI3K pathway RALA helps regulate cell proliferation and survival showing interactions with proteins such as AKT1. These pathways highlight the integration of RALA into broad signal transduction networks important for cellular homeostasis.

The altered regulation of RALA links it to cancer and neuronal disorders. In cancer the dysregulation of RALA can drive tumorigenesis often acting alongside proteins like KRAS in promoting oncogenic signaling. In neuronal disorders improper functioning of RALA has been associated with synaptic dysfunctions potentially affecting proteins like Synapsin I which are important to synaptic vesicle trafficking. Understanding RALA's role in these contexts helps in developing targeted therapeutic strategies.

Specifications

Form

Liquid

Additional notes

ab227388 was purified using conventional chromatography techniques.

General info

Function

Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Key regulator of LPAR1 signaling and competes with GRK2 for binding to LPAR1 thus affecting the signaling properties of the receptor. Required for anchorage-independent proliferation of transformed cells (By similarity). The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling (PubMed : 20005108). During mitosis, supports the stabilization and elongation of the intracellular bridge between dividing cells. Cooperates with EXOC2 to recruit other components of the exocyst to the early midbody (By similarity). During mitosis, also controls mitochondrial fission by recruiting to the mitochondrion RALBP1, which mediates the phosphorylation and activation of DNM1L by the mitotic kinase cyclin B-CDK1 (By similarity).

Sequence similarities

Belongs to the small GTPase superfamily. Ras family.

Post-translational modifications

Prenylation is essential for membrane localization.. Phosphorylated. Phosphorylation at Ser-194 by AURKA/Aurora kinase A, during mitosis, induces RALA localization to the mitochondrion where it regulates mitochondrial fission.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Key regulator of LPAR1 signaling and competes with GRK2 for binding to LPAR1 thus affecting the signaling properties of the receptor. Required for anchorage-independent proliferation of transformed cells (By similarity). The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling (PubMed : 20005108). During mitosis, supports the stabilization and elongation of the intracellular bridge between dividing cells. Cooperates with EXOC2 to recruit other components of the exocyst to the early midbody (By similarity). During mitosis, also controls mitochondrial fission by recruiting to the mitochondrion RALBP1, which mediates the phosphorylation and activation of DNM1L by the mitotic kinase cyclin B-CDK1 (By similarity).
See full target information Rala

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Stem cell research & therapy 11:455 PubMed33109266

2020

microRNA-375 released from extracellular vesicles of bone marrow mesenchymal stem cells exerts anti-oncogenic effects against cervical cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Feng Ding,Jinhua Liu,Xiaofei Zhang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com