JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307187

Recombinant Mouse RANKL Protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Mouse RANKL Protein (Active) is a Mouse Fragment protein, in the 141 to 316 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, FuncS, Cell Culture, SDS-PAGE, Mass Spec.

View Alternative Names

CD254, Opgl, Rankl, Trance, Tnfsf11, Tumor necrosis factor ligand superfamily member 11, Osteoclast differentiation factor, Osteoprotegerin ligand, Receptor activator of nuclear factor kappa-B ligand, TNF-related activation-induced cytokine, ODF, OPGL, RANKL, TRANCE

3 Images
Mass Spectrometry - Recombinant Mouse RANKL Protein (Active) (AB307187)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse RANKL Protein (Active) (AB307187)

Mass determination by ESI-TOF. Predicted MW is 19539.97 Da (+/- 10 Da by ESI-TOF). Observed MW is 19541.33 Da.

Functional Studies - Recombinant Mouse RANKL Protein (Active) (AB307187)
  • FuncS

Supplier Data

Functional Studies - Recombinant Mouse RANKL Protein (Active) (AB307187)

Fully biologically active determined by the dose dependent NF-ΚB activation of mouse RAW 264.7 macrophages overexpressing AP-1 and NF-ΚB inducible SEAP reporter gene. Results obtained with Invivogen RAW Blue™ cells (Cat code.,raw-sp). ED50 ≤ 207 ng/ml, corresponding to a specific activity of 4.8 x 103 units/mg.

SDS-PAGE - Recombinant Mouse RANKL Protein (Active) (AB307187)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse RANKL Protein (Active) (AB307187)

SDS-page analysis of ab307187

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, Cell Culture, SDS-PAGE, FuncS, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent NF-ΚB activation of mouse RAW 264.7 macrophages overexpressing AP-1 and NF-ΚB inducible SEAP reporter gene. Results obtained with InvivoGen RAW Blue™ cells (Cat code.,raw-sp). ED50 ≤ 207 ng/ml, corresponding to a specific activity of 4.8 x 10^3 units/mg.

Accession

O35235

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"GAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID","proteinLength":"Fragment","predictedMolecularWeight":"19.54 kDa","actualMolecularWeight":"19.54 kDa","aminoAcidEnd":316,"aminoAcidStart":141,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O35235","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

General info

Function

Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor (PubMed : 22437732). Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (By similarity). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts (PubMed : 18586671, PubMed : 24039232, PubMed : 27336669). During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation (PubMed : 23395171, PubMed : 26644563).

Sequence similarities

Belongs to the tumor necrosis factor family.

Post-translational modifications

N-glycosylated.. The soluble form of isoform 1 derives from the membrane form by proteolytic processing. The cleavage may be catalyzed by ADAM17. A further shorter soluble form was observed.

Product protocols

Target data

Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor (PubMed : 22437732). Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (By similarity). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts (PubMed : 18586671, PubMed : 24039232, PubMed : 27336669). During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation (PubMed : 23395171, PubMed : 26644563).
See full target information Tnfsf11

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

International journal of molecular sciences 25: PubMed38928460

2024

Onion ( L.) Flavonoid Extract Ameliorates Osteoporosis in Rats Facilitating Osteoblast Proliferation and Differentiation in MG-63 Cells and Inhibiting RANKL-Induced Osteoclastogenesis in RAW 264.7 Cells.

Applications

Unspecified application

Species

Unspecified reactive species

Danyang Zhang,Xiaoyu Wang,Kezhuo Sun,Jianli Guo,Jia Zhao,Yuesheng Dong,Yongming Bao
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com