JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276789

Recombinant Mouse Reg3a protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Reg3a protein (His tag) is a Mouse Full Length protein, in the 1 to 175 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Pap2, Reg3a, Regenerating islet-derived protein 3-alpha, REG-3-alpha, Islet of Langerhans regenerating protein 3, Lithostathine 3, Pancreatitis-associated protein 2, Regenerating islet-derived protein III-alpha, Reg III-alpha

1 Images
SDS-PAGE - Recombinant Mouse Reg3a protein (His tag) (AB276789)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse Reg3a protein (His tag) (AB276789)

SDS-PAGE analysis of ab276789

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O09037

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MLPHLVLNSISWMLLSCLLFVFQVQGEDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ","proteinLength":"Full Length","predictedMolecularWeight":"18 kDa","actualMolecularWeight":null,"aminoAcidEnd":175,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O09037","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Reg3a also known as regenerating islet-derived protein 3 alpha or PAP1 (pancreatitis-associated protein 1) is a C-type lectin with a molecular mass of approximately 19 kDa. This protein is primarily found in the epithelial cells of the intestinal tract where it plays a significant role in the mucosal immune response. Reg3a is secreted into the intestinal lumen indicating its importance in maintaining gut homeostasis and defending against pathogenic bacteria. Expression of Reg3a increases upon inflammatory stimuli suggesting a strong link between inflammation and its function.
Biological function summary

Reg3a acts as an antimicrobial peptide that targets bacterial cell walls specifically binding to peptidoglycans. This ability to bind and break down the cell wall helps in controlling bacterial populations within the gut therefore Reg3a becomes an innate defense component. It works independently and is not known to be part of a larger protein complex. Moreover Reg3a shows bactericidal activity against Gram-positive bacteria contributing to the maintenance of a healthy gut flora.

Pathways

Reg3a functions prominently in the innate immune response and inflammatory pathways. The protein gets upregulated in response to cytokines like Interleukin-22 (IL-22) which helps Reg3a to exert its antimicrobial properties. Reg3a shares relatedness with proteins like Reg3g when considering their roles in the protection of intestinal epithelial barriers. These proteins work together to safeguard the gut lining by destroying harmful bacterial invaders therefore playing an important role in maintaining intestinal integrity.

Reg3a has been implicated in inflammatory bowel diseases such as Crohn's disease and ulcerative colitis. Studies show altered expression levels of Reg3a in these disorders connecting its antimicrobial function with disease pathogenesis. Additionally Reg3a shows as a biomarker for pancreatic disorders such as chronic pancreatitis potentially due to changes in its expression during inflammatory episodes. Reg3a engages with inflammation-related proteins including Tumor Necrosis Factor-alpha (TNF-alpha) which may influence disease outcomes and progression.

Specifications

Form

Lyophilized

General info

Function

Bactericidal C-type lectin. The lack of the EPN motif may explain its inability to bind peptidoglycan.. Acts as a hormone in response to different stimuli like anti-inflammatory signals, such as IL17A, or gut microbiome. Secreted by different cell types to activate its receptor EXTL3 and induce cell specific signaling pathways. Induced by IL17A in keratinocytes, regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway (By similarity). In parallel, inhibits skin inflammation through the inhibition of inflammatory cytokines such as IL6 and TNF (PubMed : 22727489). In pancreas, is able to permealize beta-cells membrane and stimulate their proliferation (PubMed : 36240759).

Post-translational modifications

Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for peptidoglycan binding and antibacterial activity.

Product protocols

Target data

Bactericidal C-type lectin. The lack of the EPN motif may explain its inability to bind peptidoglycan.. Acts as a hormone in response to different stimuli like anti-inflammatory signals, such as IL17A, or gut microbiome. Secreted by different cell types to activate its receptor EXTL3 and induce cell specific signaling pathways. Induced by IL17A in keratinocytes, regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway (By similarity). In parallel, inhibits skin inflammation through the inhibition of inflammatory cytokines such as IL6 and TNF (PubMed : 22727489). In pancreas, is able to permealize beta-cells membrane and stimulate their proliferation (PubMed : 36240759).
See full target information Reg3a

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com