JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB109341

Recombinant Mouse S100A4 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Mouse S100A4 protein is a Mouse Full Length protein, in the 1 to 101 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Capl, Mts1, S100a4, Protein S100-A4, Metastasin, Metastatic cell protein, PEL98, Placental calcium-binding protein, Protein 18A2, Protein Mts1, S100 calcium-binding protein A4

1 Images
SDS-PAGE - Recombinant Mouse S100A4 protein (AB109341)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Mouse S100A4 protein (AB109341)

15% SDS-PAGE analysis of 3 μg ab109341.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P07091

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0308% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK","proteinLength":"Full Length","predictedMolecularWeight":"13.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":101,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P07091","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

S100A4 also known as metastasin or MTS1 is a protein with a molecular weight of approximately 12 kDa. It functions by binding calcium which induces conformational changes aiding in its interaction with target proteins. S100A4 is part of the S100 family of proteins characterized by two EF-hand calcium-binding motifs. Expression of S100A4 is observed in various cell types including fibroblasts endothelial cells and several tumor cells where it contributes to processes like cell motility invasion and angiogenesis.
Biological function summary

The role of S100A4 extends beyond mere calcium binding; it associates with the cytoskeleton promoting cell structures related to movement and metastasis. It does not act alone but often partners with proteins like myosin IIA to regulate cytoskeletal dynamics. Additionally S100A4 modulates extracellular matrix components and interacts with signaling pathways that control cancer progression making it significant in both normal physiological contexts and pathological states.

Pathways

Functional activities of S100A4 integrate into important pathways involved in cellular movement and metastasis. S100A4 plays roles in the regulation of the Wnt/β-catenin pathway which is pivotal for cell-cell interaction and fate determination. It also interacts with matrix metalloproteinases like MMPs thereby managing processes of tissue invasion and remodeling essential in cancer metastasis. Other pathways influencing cell adhesion and signal transduction may indirectly involve S100A4 through related proteins.

Elevated S100A4 levels have implications in cancer particularly in enhancing metastasis in breast and colorectal cancers. The protein promotes tumor developments by inducing changes in the tumor microenvironment making it a target of interest in oncology. S100A4 also interacts with proteins like p53 and β-catenin which are critical in the pathology of tumors. Moreover S100A4 contributes to fibrotic diseases accentuating tissue remodeling activities by modulating fibroblast behavior and extracellular matrix deposition.

Specifications

Form

Liquid

Additional notes

ab109341 is purified using conventional chromatography techniques.

General info

Function

Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy (PubMed : 20519440). Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9 (PubMed : 8051043). Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis (PubMed : 8051043). Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels (By similarity). Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes (PubMed : 20103644). In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors (By similarity).

Sequence similarities

Belongs to the S-100 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy (PubMed : 20519440). Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9 (PubMed : 8051043). Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis (PubMed : 8051043). Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels (By similarity). Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes (PubMed : 20103644). In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors (By similarity).
See full target information S100a4

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

The Journal of biological chemistry 300:105530 PubMed38072048

2023

A novel mechanoeffector role of fibroblast S100A4 in myofibroblast transdifferentiation and fibrosis.

Applications

Unspecified application

Species

Unspecified reactive species

Brian D Southern,Haiyan Li,Hongxia Mao,James F Crish,Lisa M Grove,Rachel G Scheraga,Sanaa Mansoor,Amanda Reinhardt,Susamma Abraham,Gauravi Deshpande,Alicia Loui,Andrei I Ivanov,Steven S Rosenfeld,Anne R Bresnick,Mitchell A Olman
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com