JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB108120

Recombinant Mouse S100A8 protein

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Mouse S100A8 protein is a Mouse Full Length protein, in the 1 to 89 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Caga, Mrp8, S100a8, Protein S100-A8, Calgranulin-A, Chemotactic cytokine CP-10, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8, Pro-inflammatory S100 cytokine, S100 calcium-binding protein A8, MRP-8, p8

1 Images
SDS-PAGE - Recombinant Mouse S100A8 protein (AB108120)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Mouse S100A8 protein (AB108120)

15% SDS-PAGE showing ab108120 at approximately 12.4kDa (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P27005

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE","proteinLength":"Full Length","predictedMolecularWeight":"12.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":89,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P27005","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

S100A8 also known as calprotectin or MRP8 is a calcium-binding protein with a molecular weight of around 10.8 kDa. It is a member of the S100 protein family and is found expressed in myeloid cells such as neutrophils and monocytes. This protein often forms a heterodimer complex with S100A9 together referred to as calprotectin which plays a critical role in the immune response. Researchers frequently utilize calprotectin fecal ELISA MRP8 ELISA or calprotectin serum immunoassay to measure its levels in various biological samples.
Biological function summary

The S100A8/S100A9 complex modulates inflammatory processes and immune responses. It acts as a pro-inflammatory mediator and is associated with leukocyte recruitment to sites of inflammation. This complex plays an important role in protecting cells from infections by inhibiting bacterial growth through sequestration of nutrient metals showcasing antimicrobial properties. Calprotectin significantly impacts immune responses and has become an interesting target for calprotectin ELISA kits to quantify its presence in plasma and other bodily fluids indicating inflammation.

Pathways

S100A8 and its partner S100A9 are involved in toll-like receptor and receptor for advanced glycation end-products (RAGE) signaling pathways. These pathways are key in mediating inflammatory responses and linking to innate immunity. The calgranulin A ELISA is often used to evaluate their involvement in these pathways helping to elucidate interactions with other proteins like calmodulin that play a role in cellular regulation processes.

S100A8 is strongly associated with inflammatory conditions such as rheumatoid arthritis and inflammatory bowel disease. Its elevated expression levels serve as a biomarker for these conditions highlighting its potential for diagnostic use via calprotectin ELISA kits. S100A8's relationship with S100A9 supports its connection to these diseases reflecting the complex's significant presence and functional role in chronic inflammation and immune dysregulation.

Specifications

Form

Liquid

Additional notes

ab108120 is purified using conventional chromatography techniques.

General info

Function

S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include : facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Participates also in regulatory T-cell differentiation together with CD69. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 seems to contribute to S-nitrosylation site selectivity (By similarity).. (Microbial infection) Upon infection by murine coronavirus (MHV-A59), induces expansion of aberrant immature neutrophils in a TLR4-dependent manner.

Sequence similarities

Belongs to the S-100 family.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include : facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Participates also in regulatory T-cell differentiation together with CD69. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 seems to contribute to S-nitrosylation site selectivity (By similarity).. (Microbial infection) Upon infection by murine coronavirus (MHV-A59), induces expansion of aberrant immature neutrophils in a TLR4-dependent manner.
See full target information S100a8

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Journal of neuroinflammation 15:252 PubMed30180864

2018

Hippocampal Mrp8/14 signaling plays a critical role in the manifestation of depressive-like behaviors in mice.

Applications

Unspecified application

Species

Unspecified reactive species

Hong Gong,Wen-Jun Su,Zhi-Yong Cao,Yong-Jie Lian,Wei Peng,Yun-Zi Liu,Yi Zhang,Lin-Lin Liu,Ran Wu,Bo Wang,Ting Zhang,Yun-Xia Wang,Chun-Lei Jiang

Journal of cellular physiology 230:2998-3008 PubMed25953201

2015

S100A8, An Oocyte-Specific Chemokine, Directs the Migration of Ovarian Somatic Cells During Mouse Primordial Follicle Assembly.

Applications

Unspecified application

Species

Unspecified reactive species

Zhen Teng,Chao Wang,Yijing Wang,Kun Huang,Xi Xiang,Wanbao Niu,Lizhao Feng,Lihua Zhao,Hao Yan,Hua Zhang,Guoliang Xia
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com