JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB109951

Recombinant Mouse S100A9 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Mouse S100A9 protein is a Mouse Full Length protein, in the 1 to 113 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Cagb, Mrp14, S100a9, Protein S100-A9, Calgranulin-B, Leukocyte L1 complex heavy chain, Migration inhibitory factor-related protein 14, S100 calcium-binding protein A9, MRP-14, p14

1 Images
SDS-PAGE - Recombinant Mouse S100A9 protein (AB109951)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Mouse S100A9 protein (AB109951)

15% SDS-PAGE analysis of ab109951 (3μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P31725

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK","proteinLength":"Full Length","predictedMolecularWeight":"15.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":113,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P31725","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

S100A9 also known as calgranulin B or MRP-14 is a calcium-binding protein with a molecular weight of approximately 13 kDa. It belongs to the S100 family and forms part of a heterodimeric complex with S100A8. S100A9 is largely found in myeloid cells such as neutrophils and monocytes. It plays a significant role in the cytosol and can be secreted to the extracellular space under specific stress conditions.
Biological function summary

S100A9 impacts inflammatory responses and immune regulation. It partners with S100A8 to form the calprotectin complex which acts as a strong pro-inflammatory mediator. This complex binds to receptors like RAGE and TLR4 initiating signaling pathways that promote inflammation. S100A9 also participates in leukocyte recruitment and has antimicrobial properties blocking the growth of bacteria and fungi by chelating essential metal ions.

Pathways

Several are influenced by S100A9 including the NF-kB and MAPK signaling pathways. Through its interaction with RAGE and TLR4 receptors S100A9 influences the activation of these pathways which are important in the regulation of inflammatory and immune responses. Other proteins involved in these pathways include MyD88 for TLR4 signaling and various kinases for MAPK signaling positioning S100A9 as an important regulator within the inflammatory networks.

S100A9 links to various inflammatory and autoimmune conditions such as rheumatoid arthritis and inflammatory bowel disease. Increased levels of S100A9 have been observed in these conditions where it augments the inflammatory response. In rheumatoid arthritis for example S100A9 upregulation correlates with increased joint inflammation and damage. The protein’s interaction with S100A8 in these diseases highlights its contribution to the pathogenesis and progression of inflammation-related conditions.

Specifications

Form

Liquid

Additional notes

ab109951 was purified using conventional chromatography.

General info

Function

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed : 15331440, PubMed : 17767165, PubMed : 18403730, PubMed : 19402754, PubMed : 22804476, PubMed : 34562450). It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism (By similarity). Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions (By similarity). The intracellular functions include : facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase (PubMed : 15331440). Participates also in regulatory T-cell differentiation together with CD69 (By similarity). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX (By similarity). The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities (PubMed : 21382888). Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration (By similarity). Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) (PubMed : 17767165, PubMed : 18403730, PubMed : 19402754). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade (PubMed : 17767165, PubMed : 18403730, PubMed : 19402754, PubMed : 22804476). Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth (By similarity). Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3 (By similarity). Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK (By similarity). Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants (By similarity). The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (By similarity).

Sequence similarities

Belongs to the S-100 family.

Post-translational modifications

Phosphorylated. Phosphorylation inhibits activation of tubulin polymerization.. Methylation at His-107 by METTL9 reduces zinc-binding without affecting heterodimerization with S100A8.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed : 15331440, PubMed : 17767165, PubMed : 18403730, PubMed : 19402754, PubMed : 22804476, PubMed : 34562450). It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism (By similarity). Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions (By similarity). The intracellular functions include : facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase (PubMed : 15331440). Participates also in regulatory T-cell differentiation together with CD69 (By similarity). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX (By similarity). The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities (PubMed : 21382888). Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration (By similarity). Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) (PubMed : 17767165, PubMed : 18403730, PubMed : 19402754). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade (PubMed : 17767165, PubMed : 18403730, PubMed : 19402754, PubMed : 22804476). Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth (By similarity). Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3 (By similarity). Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK (By similarity). Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants (By similarity). The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (By similarity).
See full target information S100a9

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Journal of neuroinflammation 15:252 PubMed30180864

2018

Hippocampal Mrp8/14 signaling plays a critical role in the manifestation of depressive-like behaviors in mice.

Applications

Unspecified application

Species

Unspecified reactive species

Hong Gong,Wen-Jun Su,Zhi-Yong Cao,Yong-Jie Lian,Wei Peng,Yun-Zi Liu,Yi Zhang,Lin-Lin Liu,Ran Wu,Bo Wang,Ting Zhang,Yun-Xia Wang,Chun-Lei Jiang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com