JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB217568

Recombinant Mouse SLAM / CD150 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse SLAM / CD150 protein (His tag) is a Mouse Fragment protein, in the 25 to 242 aa range, expressed in Mammalian, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD150, Slam, Slamf1, Signaling lymphocytic activation molecule, SLAM family member 1

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Mammalian

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9QUM4

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in water

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPVDHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"25.22 kDa","actualMolecularWeight":null,"aminoAcidEnd":242,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Mammalian","accessionNumber":"Q9QUM4","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SLAM also known as CD150 is a cell surface glycoprotein with a molecular weight of approximately 70 kDa. It is mainly expressed on immune cells such as T cells B cells dendritic cells and macrophages. SLAM/CD150 serves as a receptor that plays an important role in cellular communication by transmitting signals across the cell membrane. These signals influence various immune responses and cellular functions.
Biological function summary

SLAM/CD150 acts as a co-stimulatory molecule that augments the activation and proliferation of T and B cells. It participates in forming signaling complexes through interactions with SLAM-associated protein (SAP). As part of these complexes SLAM/CD150 regulates cytokine production and modulates immune cell interactions and responses. Furthermore SLAM/CD150 engagement impacts the stability and formation of immunological synapses.

Pathways

SLAM/CD150 plays a significant role in the immune signaling cascade. It is involved in the SLAM receptor signaling pathway and interacts closely with proteins like SAP and SH2D1A. These interactions enable signal transduction that modulates downstream effects in T and B cell activation within the immune system. SLAM/CD150's activity affects lymphocyte development and adaptive immune responses.

SLAM/CD150 is connected to autoimmune disorders and infectious diseases. Its altered signaling contributes to disorders such as X-linked lymphoproliferative disease where interactions with the SAP protein are disrupted. Additionally SLAM/CD150 serves as a receptor for certain viruses including measles virus implicating it in viral pathogenesis and immune evasion mechanisms. Understanding these associations helps elucidate potential therapeutic targets for managing these conditions.

Specifications

Form

Lyophilized

General info

Function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. SLAMF1-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAMF1 signaling seem to exist : one depending on SH2D1A (and perhaps SH2D1B) and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates. Initially it has been proposed that association with SH2D1A prevents binding to inhibitory effectors including INPP5D/SHIP1 and PTPN11/SHP-2 (By similarity). However, signaling is also regulated by SH2D1A which can simultaneously interact with and recruit FYN which subsequently phosphorylates and activates SLAMF1 (By similarity). Mediates IL-2-independent proliferation of activated T-cells during immune responses and induces IFN-gamma production (PubMed : 12351401, PubMed : 9126961). Downstreaming signaling involves INPP5D, DOK1 and DOK2 leading to inhibited IFN-gamma production in T-cells, and PRKCQ, BCL10 and NFKB1 leading to increased T-cell activation and Th2 cytokine production (PubMed : 11477403, PubMed : 15539155, PubMed : 16847311). Promotes T-cell receptor-induced IL-4 secretion by CD4(+) cells (PubMed : 15123745). Inhibits antigen receptor-mediated production of IFN-gamma, but not IL-2, in CD4(-)/CD8(-) T-cells (PubMed : 11477403). Required for IL-4 production by germinal centers T follicular helper (T(Fh))cells (PubMed : 20525889). May inhibit CD40-induced signal transduction in monocyte-derived dendritic cells (By similarity). May play a role in allergic responses and may regulate allergen-induced Th2 cytokine and Th1 cytokine secretion (PubMed : 16528012). In conjunction with SLAMF6 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage (PubMed : 18031695). Involved in the peripheral differentiation of indifferent natural killer T (iNKT) cells toward a regulatory NKT2 type (PubMed : 18606638). In macrophages involved in down-regulation of IL-12, TNF-alpha and nitric oxide in response to lipopolysaccharide (LPS) (PubMed : 15123745). In B-cells activates the ERK signaling pathway independently of SH2D1A but implicating both, SYK and INPP5D, and activates Akt signaling dependent on SYK and SH2D1A (PubMed : 15315965). In conjunction with CD84/SLAMF5 and SLAMF6 may be a negative regulator of the humoral immune response (PubMed : 25926831).. (Microbial infection) Involved in innate immune response against Gram-negative bacteria in macrophages; probably recognizes OmpC and/or OmpF on the bacterial surface, regulates phagosome maturation and recruitment of the PI3K complex II (PI3KC3-C2) leading to accumulated of PdtIns(3)P and NOX2 activity in the phagosomes (PubMed : 20818396, PubMed : 22493499).

Post-translational modifications

Phosphorylated on tyrosine residues by FYN (By similarity).

Product protocols

Target data

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. SLAMF1-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAMF1 signaling seem to exist : one depending on SH2D1A (and perhaps SH2D1B) and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates. Initially it has been proposed that association with SH2D1A prevents binding to inhibitory effectors including INPP5D/SHIP1 and PTPN11/SHP-2 (By similarity). However, signaling is also regulated by SH2D1A which can simultaneously interact with and recruit FYN which subsequently phosphorylates and activates SLAMF1 (By similarity). Mediates IL-2-independent proliferation of activated T-cells during immune responses and induces IFN-gamma production (PubMed : 12351401, PubMed : 9126961). Downstreaming signaling involves INPP5D, DOK1 and DOK2 leading to inhibited IFN-gamma production in T-cells, and PRKCQ, BCL10 and NFKB1 leading to increased T-cell activation and Th2 cytokine production (PubMed : 11477403, PubMed : 15539155, PubMed : 16847311). Promotes T-cell receptor-induced IL-4 secretion by CD4(+) cells (PubMed : 15123745). Inhibits antigen receptor-mediated production of IFN-gamma, but not IL-2, in CD4(-)/CD8(-) T-cells (PubMed : 11477403). Required for IL-4 production by germinal centers T follicular helper (T(Fh))cells (PubMed : 20525889). May inhibit CD40-induced signal transduction in monocyte-derived dendritic cells (By similarity). May play a role in allergic responses and may regulate allergen-induced Th2 cytokine and Th1 cytokine secretion (PubMed : 16528012). In conjunction with SLAMF6 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage (PubMed : 18031695). Involved in the peripheral differentiation of indifferent natural killer T (iNKT) cells toward a regulatory NKT2 type (PubMed : 18606638). In macrophages involved in down-regulation of IL-12, TNF-alpha and nitric oxide in response to lipopolysaccharide (LPS) (PubMed : 15123745). In B-cells activates the ERK signaling pathway independently of SH2D1A but implicating both, SYK and INPP5D, and activates Akt signaling dependent on SYK and SH2D1A (PubMed : 15315965). In conjunction with CD84/SLAMF5 and SLAMF6 may be a negative regulator of the humoral immune response (PubMed : 25926831).. (Microbial infection) Involved in innate immune response against Gram-negative bacteria in macrophages; probably recognizes OmpC and/or OmpF on the bacterial surface, regulates phagosome maturation and recruitment of the PI3K complex II (PI3KC3-C2) leading to accumulated of PdtIns(3)P and NOX2 activity in the phagosomes (PubMed : 20818396, PubMed : 22493499).
See full target information Slamf1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com