JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB95307

Recombinant Mouse Sonic Hedgehog protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse Sonic Hedgehog protein (His tag C-Terminus) is a Mouse Fragment protein, in the 25 to 198 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

Hhg1, Shh, Sonic hedgehog protein, SHH, HHG-1, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhNC

1 Images
SDS-PAGE - Recombinant Mouse Sonic Hedgehog protein (His tag C-Terminus) (AB95307)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Mouse Sonic Hedgehog protein (His tag C-Terminus) (AB95307)

15% SDS-PAGE analysis of 3μg ab95307

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q62226

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGLEHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":198,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q62226","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Sonic Hedgehog also known as SHH is a protein that plays an important role in cell signaling during embryonic development. It has alternative names like 'HHG-1' and '5h4'. The Sonic Hedgehog protein is about 45 kDa in mass. Scientists find SHH expression in various tissues including the brain lungs and limb buds. Its activity plays a role in the organization of several tissue structures during development helping to regulate cellular growth and differentiation processes.
Biological function summary

Sonic Hedgehog is critical for the vertebrate embryonic patterning and organogenesis. It functions as a signaling molecule and is part of the Hedgehog signaling complex. The protein acts by binding to the Patched receptor further influencing the Smoothened transducer in cellular signaling cascades. This signaling contributes to the proper formation of limbs central nervous system structures and other vital organs in early development stages.

Pathways

Sonic Hedgehog participates in essential signaling pathways such as the Hedgehog pathway and the Wnt signaling pathway. It interacts with proteins including the Patched and Smoothened to facilitate downstream genetic transcription regulation. Through these pathways Sonic Hedgehog influences the transcription of specific genes that control cell growth. These interactions contribute to the regulation of different cell types and the organization of distinct tissue areas.

Sonic Hedgehog connects to issues like cancer and congenital malformations. Aberrations in its signaling can lead to conditions such as basal cell carcinoma and holoprosencephaly. Sonic Hedgehog through its influence on the Hedgehog signaling pathway implicates interactions with other proteins like GLI transcription factors and Patched. These interactions can dysregulate cellular processes and result in disease states when not functioning correctly.

Specifications

Form

Liquid

Additional notes

ab95307 was purified using conventional chromatography techniques.

General info

Function

Sonic hedgehog protein. The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (PubMed : 7736596, PubMed : 7891723, PubMed : 8824192). Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN (PubMed : 8824192). Both activities occur in the reticulum endoplasmic (PubMed : 21357747). Once cleaved, ShhC is degraded in the endoplasmic reticulum (PubMed : 21357747).. Sonic hedgehog protein N-product. The dually lipidated sonic hedgehog protein N-product (ShhNp) is a morphogen which is essential for a variety of patterning events during development. Induces ventral cell fate in the neural tube and somites (PubMed : 11430830, PubMed : 24863049). Involved in the patterning of the anterior-posterior axis of the developing limb bud (PubMed : 15315762). Essential for axon guidance (PubMed : 12679031). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (By similarity). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (By similarity).

Sequence similarities

Belongs to the hedgehog family.

Post-translational modifications

Sonic hedgehog protein. The C-terminal domain displays an autoproteolysis activity and a cholesterol transferase activity (PubMed:7736596, PubMed:7891723, PubMed:8824192). Both activities result in the cleavage of the full-length protein and covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-terminal fragment (ShhN) (PubMed:7736596, PubMed:7891723, PubMed:8824192). Cholesterylation is required for the sonic hedgehog protein N-product targeting to lipid rafts and multimerization (PubMed:24522195, PubMed:8824192). ShhN is the active species in both local and long-range signaling, whereas the C-product (ShhC) is degraded in the reticulum endoplasmic (PubMed:21357747).. Sonic hedgehog protein N-product. N-palmitoylation by HHAT of ShhN is required for sonic hedgehog protein N-product multimerization and full activity (PubMed:11486055, PubMed:15075292). It is a prerequisite for the membrane-proximal positioning and the subsequent shedding of this N-terminal peptide (PubMed:24522195).. Sonic hedgehog protein N-product. The lipidated N- and C-terminal peptides of ShhNp can be cleaved (shedding) (PubMed:24522195). The N-terminal palmitoylated peptide is cleaved at the Cardin-Weintraub (CW) motif site (PubMed:24522195). The cleavage reduced the interactions with heparan sulfate (PubMed:23118222). The cleavage is enhanced by SCUBE2.

Product protocols

Target data

Sonic hedgehog protein. The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity (PubMed : 7736596, PubMed : 7891723, PubMed : 8824192). Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN (PubMed : 8824192). Both activities occur in the reticulum endoplasmic (PubMed : 21357747). Once cleaved, ShhC is degraded in the endoplasmic reticulum (PubMed : 21357747).. Sonic hedgehog protein N-product. The dually lipidated sonic hedgehog protein N-product (ShhNp) is a morphogen which is essential for a variety of patterning events during development. Induces ventral cell fate in the neural tube and somites (PubMed : 11430830, PubMed : 24863049). Involved in the patterning of the anterior-posterior axis of the developing limb bud (PubMed : 15315762). Essential for axon guidance (PubMed : 12679031). Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes (By similarity). In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO (By similarity).
See full target information Shh

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com