JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276900

Recombinant Mouse sPLA2-IIE protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse sPLA2-IIE protein (His tag) is a Mouse Full Length protein, in the 1 to 142 aa range, expressed in HEK 293 cells, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Group IIE secretory phospholipase A2, GIIE sPLA2, sPLA2-IIE, Phosphatidylcholine 2-acylhydrolase 2E, Pla2g2e

1 Images
SDS-PAGE - Recombinant Mouse sPLA2-IIE protein (His tag) (AB276900)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse sPLA2-IIE protein (His tag) (AB276900)

SDS-PAGE analysis of ab276900

Key facts

Purity

>97% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9QUL3

Animal free

No

Carrier free

No

Species

Mouse

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MKPPIALACLCLLVPLAGGNLVQFGVMIERMTGKPALQYNDYGCYCGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNLNTYNRKYAHYPNKLCTGPTPPC","proteinLength":"Full Length","predictedMolecularWeight":"15.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":142,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9QUL3","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Secretory phospholipase A2 group IIE (sPLA2-IIE) is an enzyme belonging to the phospholipase A2 family also known as PLA2G2E. It has a molecular mass of approximately 14 kDa. sPLA2-IIE hydrolyzes the sn-2 position of glycerophospholipids releasing free fatty acids and lysophospholipids. This enzyme shows expression in various tissues including the pancreas and inflammatory sites where it contributes to lipid metabolism and cell membrane remodeling.
Biological function summary

Secretory phospholipase A2 group IIE plays a role in inflammation and immune responses. Its activity results in the production of arachidonic acid and lysophospholipids which are precursors for eicosanoids like prostaglandins and leukotrienes. These lipid mediators regulate inflammatory processes thereby altering cellular responses. sPLA2-IIE participates in a complex network of enzymes and receptors modulating lipid signaling and affecting diverse physiological functions.

Pathways

SPLA2-IIE interacts within the arachidonic acid pathway and the eicosanoid biosynthesis pathway. In these pathways sPLA2-IIE generates bioactive lipids impacting inflammatory signaling. It functions alongside proteins such as cyclooxygenase (COX) and lipoxygenase (LOX) which further metabolize arachidonic acid into specific eicosanoids. These pathways illustrate the enzyme's contribution to finely tuning the inflammatory response and cellular signaling networks.

Secretory phospholipase A2 group IIE associates with conditions like rheumatoid arthritis and atherosclerosis. Its enzymatic activity correlates with the inflammatory components of these diseases promoting tissue damage and disease progression. Through its involvement in lipid mediator synthesis sPLA2-IIE interacts with proteins like interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-alpha) key players in the inflammatory pathways that drive these disorders. Understanding the role of sPLA2-IIE in these diseases can help develop targeted therapies.

Specifications

Form

Lyophilized

General info

Function

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids (PubMed : 10531313, PubMed : 11922621). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity), releasing various unsaturated fatty acids including oleoate, linoleoate, arachidonate, docosahexaenoate and lysophosphatidylethanolamines in preference to lysophosphatidylcholines (By similarity). In response to high-fat diet, hydrolyzes minor lipoprotein phospholipids including phosphatidylserines, phosphatidylinositols and phosphatidylglycerols, altering lipoprotein composition and fat storage in adipose tissue and liver (PubMed : 24910243). May act in an autocrine and paracrine manner (By similarity). Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of phosphatidylglycerols and phosphatidylethanolamines, which are major components of membrane phospholipids in bacteria (By similarity). Acts as a hair follicle phospholipase A2. Selectively releases lysophosphatidylethanolamines (LPE) and various unsaturated fatty acids in skin to regulate hair follicle homeostasis (PubMed : 27226633). May regulate the inflammatory response by releasing arachidonate, a precursor of prostaglandins and leukotrienes. Upon allergen exposure, may participate in allergic inflammatory response by enhancing leukotriene C4 synthesis and degranulation in mast cells (PubMed : 11922621).

Sequence similarities

Belongs to the phospholipase A2 family.

Product protocols

Target data

Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids (PubMed : 10531313, PubMed : 11922621). Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity), releasing various unsaturated fatty acids including oleoate, linoleoate, arachidonate, docosahexaenoate and lysophosphatidylethanolamines in preference to lysophosphatidylcholines (By similarity). In response to high-fat diet, hydrolyzes minor lipoprotein phospholipids including phosphatidylserines, phosphatidylinositols and phosphatidylglycerols, altering lipoprotein composition and fat storage in adipose tissue and liver (PubMed : 24910243). May act in an autocrine and paracrine manner (By similarity). Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of phosphatidylglycerols and phosphatidylethanolamines, which are major components of membrane phospholipids in bacteria (By similarity). Acts as a hair follicle phospholipase A2. Selectively releases lysophosphatidylethanolamines (LPE) and various unsaturated fatty acids in skin to regulate hair follicle homeostasis (PubMed : 27226633). May regulate the inflammatory response by releasing arachidonate, a precursor of prostaglandins and leukotrienes. Upon allergen exposure, may participate in allergic inflammatory response by enhancing leukotriene C4 synthesis and degranulation in mast cells (PubMed : 11922621).
See full target information Pla2g2e

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com