JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB259411

Recombinant mouse TNF alpha protein (Active)

Be the first to review this product! Submit a review

|

(7 Publications)

Recombinant mouse TNF alpha protein (Active) is a Mouse Fragment protein, in the 57 to 235 aa range, expressed in HEK 293 cells, with >95%, < 0.005 EU/µg endotoxin level, suitable for sELISA, SDS-PAGE, FuncS, Mass Spec, Cell Culture, HPLC.

View Alternative Names

Tnfa, Tnfsf2, Tnf, Tumor necrosis factor, Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2, TNF-a

5 Images
Mass Spectrometry - Recombinant mouse TNF alpha protein (Active) (AB259411)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant mouse TNF alpha protein (Active) (AB259411)

M + 1.5 Da (Calc mass 19797.5 Da).

The spectrum was recorded with a 6545XT AdvanceBio LC/Q-TOF (Agilent Technologies) and a MabPac RP column (42.1x50 mm, 4 μm, Thermo Scientific). 5 μL of purified protein was injected and the gradient run from 85 % water : FA (99.9 : 0.1 v/v) and 15 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) to 55 % water : FA (99.9 : 0.1 v/v) and 45 % acetonitrile : FA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 2.5 min. Flow rate was 0.4 mL/min and the column compartment temperature was 60 °C. Data was analysed and deconvoluted using the Bioconfirm software (Agilent Technologies).

Functional Studies - Recombinant mouse TNF alpha protein (Active) (AB259411)
  • FuncS

Supplier Data

Functional Studies - Recombinant mouse TNF alpha protein (Active) (AB259411)

Fully active compared to a standard. The ED50 as determined by the dose-dependant Killing/apoptosis of L-929 cells is 1.12ng/mL corresponding to a Specific Activity of 8.93 x 105 IU/mg.

Sandwich ELISA - Recombinant mouse TNF alpha protein (Active) (AB259411)
  • sELISA

Lab

Sandwich ELISA - Recombinant mouse TNF alpha protein (Active) (AB259411)

Background subtracted standard curve using Mouse TNF alpha Antibody Pair - BSA and Azide free (ab241672) and Recombinant mouse TNF alpha protein (Active) (ab259411) in sandwich ELISA.
The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.

HPLC - Recombinant mouse TNF alpha protein (Active) (AB259411)
  • HPLC

Supplier Data

HPLC - Recombinant mouse TNF alpha protein (Active) (AB259411)

Purity 100%.

The spectrum was recorded using a 1260 Infinity II HPLC system with DAD and a MabPac RP column (3.0x100 mm, 4 μm). 5 μL of purified protein was injected and the gradient run from 80 % water : TFA (99.9 : 0.1 v/v) and 20 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) to 20 % water : TFA (99.9 : 0.1 v/v) and 80 % acetonitrile : water : TFA (90 : 9.9 : 0.1 v/v/v) within 3 minutes followed by an isocratic step for another 3 min. Flow rate was 0.5 mL/min and the column compartment temperature was 50 °C.

SDS-PAGE - Recombinant mouse TNF alpha protein (Active) (AB259411)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant mouse TNF alpha protein (Active) (AB259411)

SDS-PAGE analysis of ab259411.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Cell Culture, SDS-PAGE, HPLC, sELISA, FuncS, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully active compared to a standard. The ED50 as determined by the dose-dependant Killing/apoptosis of L-929 cells is 1.12ng/mL corresponding to a Specific Activity of 8.93 x 105 IU/mg.

Accession

P06804

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 6 - 8 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "sELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This protein is filter sterilised prior to aliquoting and lyophilisation. All aliquoting and lyophilisation steps are performed in a sterile environment

Sequence info

[{"sequence":"GPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL","proteinLength":"Fragment","predictedMolecularWeight":"19.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":235,"aminoAcidStart":57,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P06804","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

Purity by HPLC >=95%.

General info

Function

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation (By similarity). Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (PubMed : 25586176). Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6 (By similarity). Promotes osteoclastogenesis and therefore mediates bone resorption (PubMed : 32741026).. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Sequence similarities

Belongs to the tumor necrosis factor family.

Post-translational modifications

The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secreted into the extracellular space (By similarity). The soluble form derives from the membrane form by proteolytic processing.. The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1 (By similarity).. O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid.. Tumor necrosis factor, soluble form. The soluble form is demyristoylated by SIRT6, promoting its secretion.

Product protocols

Target data

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation (By similarity). Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (PubMed : 25586176). Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6 (By similarity). Promotes osteoclastogenesis and therefore mediates bone resorption (PubMed : 32741026).. The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
See full target information Tnf

Publications (7)

Recent publications for all applications. Explore the full list and refine your search

Journal of lipid research 65:100672 PubMed39396700

2024

Palmitoleate protects against lipopolysaccharide-induced inflammation and inflammasome activity.

Applications

Unspecified application

Species

Unspecified reactive species

Prakash Kumar Sahoo,Aiswariya Ravi,Baolong Liu,Jiujiu Yu,Sathish Kumar Natarajan

Autophagy 20:2616-2631 PubMed38916095

2024

Extracellular NCOA4 is a mediator of septic death by activating the AGER-NFKB pathway.

Applications

Unspecified application

Species

Unspecified reactive species

Jiao Liu,Yichun Wang,Ling Zeng,Chunhua Yu,Rui Kang,Daniel J Klionsky,Jianxin Jiang,Daolin Tang

Biomaterials 311:122663 PubMed38878481

2024

Multifaceted cancer alleviation by cowpea mosaic virus in a bioprinted ovarian cancer peritoneal spheroid model.

Applications

Unspecified application

Species

Unspecified reactive species

Yi Xiang,Zhongchao Zhao,Emmie J Yao,Alis Balayan,Steven N Fiering,Nicole F Steinmetz,Shaochen Chen

Journal of biomedical science 31:10 PubMed38243273

2024

Inactivation of pentraxin 3 suppresses M2-like macrophage activity and immunosuppression in colon cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Feng-Wei Chen,Yung-Ling Wu,Chao-Chun Cheng,Yu-Wei Hsiao,Jhih-Ying Chi,Liang-Yi Hung,Chih-Peng Chang,Ming-Derg Lai,Ju-Ming Wang

Acta neuropathologica communications 11:135 PubMed37605262

2023

Inhibition of acid sphingomyelinase reduces reactive astrocyte secretion of mitotoxic extracellular vesicles and improves Alzheimer's disease pathology in the 5xFAD mouse.

Applications

Unspecified application

Species

Unspecified reactive species

Simone M Crivelli,Zainuddin Quadri,Hemendra J Vekaria,Zhihui Zhu,Priyanka Tripathi,Ahmed Elsherbini,Liping Zhang,Patrick G Sullivan,Erhard Bieberich

Science advances 8:eabm2545 PubMed35544642

2022

Microglial GPR56 is the molecular target of maternal immune activation-induced parvalbumin-positive interneuron deficits.

Applications

Unspecified application

Species

Unspecified reactive species

Diankun Yu,Tao Li,Jean-Christophe Delpech,Beika Zhu,Priya Kishore,Tatsuhiro Koshi,Rong Luo,Karishma J B Pratt,Galina Popova,Tomasz J Nowakowski,Saul A Villeda,Xianhua Piao

PLoS pathogens 17:e1009927 PubMed34516571

2021

Host phospholipid peroxidation fuels ExoU-dependent cell necrosis and supports Pseudomonas aeruginosa-driven pathology.

Applications

Unspecified application

Species

Unspecified reactive species

Salimata Bagayoko,Stephen Adonai Leon-Icaza,Miriam Pinilla,Audrey Hessel,Karin Santoni,David Péricat,Pierre-Jean Bordignon,Flavie Moreau,Elif Eren,Aurélien Boyancé,Emmanuelle Naser,Lise Lefèvre,Céline Berrone,Nino Iakobachvili,Arnaud Metais,Yoann Rombouts,Geanncarlo Lugo-Villarino,Agnès Coste,Ina Attrée,Dara W Frank,Hans Clevers,Peter J Peters,Céline Cougoule,Rémi Planès,Etienne Meunier
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com