JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB290832

Recombinant Mouse TREM2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mouse TREM2 protein is a Mouse Fragment protein, in the 19 to 171 aa range, expressed in HEK 293 cells, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Trem2a, Trem2b, Trem2c, Trem2, Triggering receptor expressed on myeloid cells 2, TREM-2, Triggering receptor expressed on monocytes 2

2 Images
Mass Spectrometry - Recombinant Mouse TREM2 protein (AB290832)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mouse TREM2 protein (AB290832)

Mass determination by ESI-TOF. Predicted MW is 16859 Da (+/- 10 Da by ESI-TOF). Observed MW is 16860.70 Da.

SDS-PAGE - Recombinant Mouse TREM2 protein (AB290832)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mouse TREM2 protein (AB290832)

SDS-PAGE analysis of ab290832.

Key facts

Purity

undefined HPLC

Purity by SDS-PAGE>=95%

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q99NH8

Animal free

Yes

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS","proteinLength":"Fragment","predictedMolecularWeight":"16.85 kDa","actualMolecularWeight":"16.85 kDa","aminoAcidEnd":171,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q99NH8","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

General info

Function

Forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed : 11241283). Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP, and mediates its uptake and degradation by microglia (PubMed : 27477018, PubMed : 29518356). Binding to amyloid-beta 42 mediates microglial activation, proliferation, migration, apoptosis and expression of pro-inflammatory cytokines, such as IL6R and CCL3, and the anti-inflammatory cytokine ARG1 (PubMed : 27477018, PubMed : 29518356). Acts as a receptor for lipoprotein particles such as LDL, VLDL, and HDL and for apolipoproteins such as APOA1, APOA2, APOB, APOE, APOE2, APOE3, APOE4, and CLU and enhances their uptake in microglia (PubMed : 27477018). Binds phospholipids (preferably anionic lipids) such as phosphatidylserine, phosphatidylethanolamine, phosphatidylglycerol and sphingomyelin (By similarity). Regulates microglial proliferation by acting as an upstream regulator of the Wnt/beta-catenin signaling cascade (PubMed : 28077724). Required for microglial phagocytosis of apoptotic neurons (PubMed : 24990881). Also required for microglial activation and phagocytosis of myelin debris after neuronal injury and of neuronal synapses during synapse elimination in the developing brain (PubMed : 15728241, PubMed : 25631124, PubMed : 28592261, PubMed : 29752066). Regulates microglial chemotaxis and process outgrowth, and also the microglial response to oxidative stress and lipopolysaccharide (PubMed : 28483841, PubMed : 29663649, PubMed : 29859094, PubMed : 30232263). It suppresses PI3K and NF-kappa-B signaling in response to lipopolysaccharide; thus promoting phagocytosis, suppressing pro-inflammatory cytokine and nitric oxide production, inhibiting apoptosis and increasing expression of IL10 and TGFB (PubMed : 29663649). During oxidative stress, it promotes anti-apoptotic NF-kappa-B signaling and ERK signaling (PubMed : 28592261). Plays a role in microglial MTOR activation and metabolism (PubMed : 28802038). Regulates age-related changes in microglial numbers (PubMed : 25631124, PubMed : 29752066, PubMed : 30548312). Triggers activation of the immune responses in macrophages and dendritic cells. Mediates cytokine-induced formation of multinucleated giant cells which are formed by the fusion of macrophages (PubMed : 18957693). In dendritic cells, receptor of SEMA6D with PLEXNA1 as coreceptor and mediates up-regulation of chemokine receptor CCR7 and dendritic cell maturation and survival (PubMed : 16715077). Involved in the positive regulation of osteoclast differentiation (PubMed : 16418779).

Post-translational modifications

Undergoes ectodomain shedding through proteolytic cleavage by ADAM10 and ADAM17 to produce a transmembrane segment, the TREM2 C-terminal fragment (TREM2-CTF), which is subsequently cleaved by gamma-secretase.

Product protocols

Target data

Forms a receptor signaling complex with TYROBP which mediates signaling and cell activation following ligand binding (PubMed : 11241283). Acts as a receptor for amyloid-beta protein 42, a cleavage product of the amyloid-beta precursor protein APP, and mediates its uptake and degradation by microglia (PubMed : 27477018, PubMed : 29518356). Binding to amyloid-beta 42 mediates microglial activation, proliferation, migration, apoptosis and expression of pro-inflammatory cytokines, such as IL6R and CCL3, and the anti-inflammatory cytokine ARG1 (PubMed : 27477018, PubMed : 29518356). Acts as a receptor for lipoprotein particles such as LDL, VLDL, and HDL and for apolipoproteins such as APOA1, APOA2, APOB, APOE, APOE2, APOE3, APOE4, and CLU and enhances their uptake in microglia (PubMed : 27477018). Binds phospholipids (preferably anionic lipids) such as phosphatidylserine, phosphatidylethanolamine, phosphatidylglycerol and sphingomyelin (By similarity). Regulates microglial proliferation by acting as an upstream regulator of the Wnt/beta-catenin signaling cascade (PubMed : 28077724). Required for microglial phagocytosis of apoptotic neurons (PubMed : 24990881). Also required for microglial activation and phagocytosis of myelin debris after neuronal injury and of neuronal synapses during synapse elimination in the developing brain (PubMed : 15728241, PubMed : 25631124, PubMed : 28592261, PubMed : 29752066). Regulates microglial chemotaxis and process outgrowth, and also the microglial response to oxidative stress and lipopolysaccharide (PubMed : 28483841, PubMed : 29663649, PubMed : 29859094, PubMed : 30232263). It suppresses PI3K and NF-kappa-B signaling in response to lipopolysaccharide; thus promoting phagocytosis, suppressing pro-inflammatory cytokine and nitric oxide production, inhibiting apoptosis and increasing expression of IL10 and TGFB (PubMed : 29663649). During oxidative stress, it promotes anti-apoptotic NF-kappa-B signaling and ERK signaling (PubMed : 28592261). Plays a role in microglial MTOR activation and metabolism (PubMed : 28802038). Regulates age-related changes in microglial numbers (PubMed : 25631124, PubMed : 29752066, PubMed : 30548312). Triggers activation of the immune responses in macrophages and dendritic cells. Mediates cytokine-induced formation of multinucleated giant cells which are formed by the fusion of macrophages (PubMed : 18957693). In dendritic cells, receptor of SEMA6D with PLEXNA1 as coreceptor and mediates up-regulation of chemokine receptor CCR7 and dendritic cell maturation and survival (PubMed : 16715077). Involved in the positive regulation of osteoclast differentiation (PubMed : 16418779).
See full target information Trem2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com