JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB62134

Recombinant mouse VEGF 165A protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant mouse VEGF 165A protein is a Mouse Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

Vegf, Vegfa, L-VEGF, Vascular permeability factor, VPF

1 Images
Western blot - Recombinant mouse VEGF 165A protein (AB62134)
  • WB

Unknown

Western blot - Recombinant mouse VEGF 165A protein (AB62134)

ab62134 used in Western Blot. Figure : 1 ug in each lane (-) non-reducing conditions and (+) reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Mouse VEGF-165 is predicted to be a homodimer that has a predicted MW of 39 kDa.

All lanes:

Western blot - Recombinant mouse VEGF 165A protein (ab62134)

false

Key facts

Purity

>95% SDS-PAGE

Purity greater than 95% as determined by: Analysis by RP-HPLC. Reducing and non-reducing SDS-PAGE.

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Active

Accession

Q00731

Animal free

No

Carrier free

No

Species

Mouse

Reconstitution

Reconstitute at 0.1 mg/mL in water

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q00731","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

VEGF 165A or Vascular Endothelial Growth Factor 165A is an important protein that plays a role in angiogenesis which is the growth of new blood vessels. Also known as VEGF-A or VEGF isoform 165 this protein has a mass of around 23 kDa when it is in its biotinylated form. VEGF 165A is expressed in various cell types including endothelial cells which form the lining of blood vessels as well as in smooth muscle cells and certain tumor cells. The protein is often targeted in research using anti-VEGF antibodies.
Biological function summary

This protein acts directly on endothelial cells to stimulate their proliferation and migration. VEGF 165A is part of a larger family of VEGF proteins that share similar structures and functions. It plays a critical role in both physiological processes like wound healing and pathological conditions like cancer where its expression becomes dysregulated. The protein can bind to receptors on the cell surface initiating cell signaling pathways that lead to angiogenesis.

Pathways

VEGF 165A functions prominently in the VEGF signaling pathway and the MAPK/ERK pathway. Through these pathways it interacts with other proteins such as VEGF receptors particularly VEGFR-2 to propagate signals leading to angiogenesis and increased vascular permeability. These pathways are vital in ensuring that tissues receive an appropriate blood supply under various conditions including growth and repair processes.

VEGF 165A shows an association with cancer and age-related macular degeneration (AMD). Overexpression of VEGF 165A is linked to tumor growth because it helps form the blood vessels that supply the tumor known as tumor angiogenesis. Similarly in AMD abnormal blood vessel growth driven by VEGF 165A leads to damage in the retina. Anti-VEGF therapies often target this protein to treat these conditions by inhibiting its action on blood vessel formation.

General info

Function

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (PubMed : 35455969).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (PubMed : 26503042). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 16293765). May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis (By similarity).

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Post-translational modifications

Vascular endothelial growth factor A, long form. Produced by use of an alternative upstream CUG codon and post-translationally processed into the N-terminal N-VEGF form and the C-terminal secreted VEGFA form.

Product protocols

Target data

N-VEGF. Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed : 35455969). Involved in protecting cells from hypoxia-mediated cell death (PubMed : 35455969).. VEGFA. Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binds to the NRP1/neuropilin-1 receptor. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (PubMed : 26503042). Also binds the DEAR/FBXW7-AS1 receptor (PubMed : 16293765). May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis (By similarity).
See full target information Vegfa

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com