JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB225596

Recombinant Mycobacterium tuberculosis Ag85 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mycobacterium tuberculosis Ag85 protein (His tag) is a Mycobacterium tuberculosis H37Rv Full Length protein, in the 46 to 340 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

mpt45, Rv0129c, MTCI5.03c, fbpC, Diacylglycerol acyltransferase/mycolyltransferase Ag85C, DGAT, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex C, Fibronectin-binding protein C, 85C, Ag85C, Fbps C

3 Images
Mass Spectrometry - Recombinant Mycobacterium tuberculosis Ag85 protein (His tag) (AB225596)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mycobacterium tuberculosis Ag85 protein (His tag) (AB225596)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225596 could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Ag85.

Mass Spectrometry - Recombinant Mycobacterium tuberculosis Ag85 protein (His tag) (AB225596)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mycobacterium tuberculosis Ag85 protein (His tag) (AB225596)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225596 could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Ag85.

SDS-PAGE - Recombinant Mycobacterium tuberculosis Ag85 protein (His tag) (AB225596)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mycobacterium tuberculosis Ag85 protein (His tag) (AB225596)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225596 with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P9WQN9

Animal free

No

Carrier free

No

Species

Mycobacterium tuberculosis H37Rv

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA","proteinLength":"Full Length","predictedMolecularWeight":"36.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":340,"aminoAcidStart":46,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P9WQN9","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein Mycobacterium tuberculosis Ag85 also called Ag85 complex or Ag-85 consists of a series of related proteins secreted by Mycobacterium tuberculosis including Ag85A Ag85B and Ag85C. This protein family plays a central role in the pathogen's ability to synthesize mycolic acids. The Ag85 complex has a molecular mass of around 30 to 32 kDa and is abundantly expressed on the surface of the Mycobacterium tuberculosis cell wall.
Biological function summary

The Ag85 complex facilitates the synthesis and transfer of mycolic acids essential constituents of the mycobacterial cell wall's lipid-rich structure. The Ag85 proteins participate in forming this barrier allowing Mycobacterium tuberculosis to resist host immune defenses. This functionality is linked to its involvement in the mycolyltransferase enzyme system which operates in collaboration with several other proteins necessary for full cell wall biosynthesis.

Pathways

The Ag85 complex significantly contributes to the biosynthetic route of mycolic acids an integral component of mycobacterial cell walls. This pathway includes interactions with other proteins like Pks13 and Mycobacterial arabinosyltransferase (EmbB) both important for the complex architectural integrity and viability of the mycobacterial cell wall. This biosynthesis pathway ensures proper assembly and maintenance of the cell envelope enhancing the persistence of the bacteria.

The Ag85 proteins are critical in the pathogenesis of tuberculosis where their activity supports the survival of the bacteria within host macrophages. Ag85 complexes are considered potential targets for diagnostic and therapeutic applications against tuberculosis. Additionally in leprosy another disease caused by mycobacteria proteins of the Ag85 complex have shown cross-reactivity emphasizing their significant role in bacterial viability and immune response evasion.

Specifications

Form

Liquid

General info

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.

Sequence similarities

Belongs to the mycobacterial A85 antigen family.

Product protocols

Target data

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.
See full target information fbpC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com