JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB240770

Recombinant Mycobacterium tuberculosis TB Ag85A protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Mycobacterium tuberculosis TB Ag85A protein (His tag) is a Mycobacterium tuberculosis CDC1551 Fragment protein, in the 53 to 331 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

mpt44, MT3911, fbpA, Diacylglycerol acyltransferase/mycolyltransferase Ag85A, DGAT, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex A, Fibronectin-binding protein A, 85A, Ag85A, Fbps A, 85A, 85 A, FbpA, Ag85A, Fbp A, Mpt44, Mpt 44, Rv3804c, Antigen 85A, Antigen 85 A, Antigen 85 complex A, Secreted antigen Ag85A, Mycolyl transferase 85A, Mycolyl transferase 85 A, Fibronectin binding protein A, Mycobacterium tuberculosis antigen 85A

3 Images
Mass Spectrometry - Recombinant Mycobacterium tuberculosis TB Ag85A protein (His tag) (AB240770)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mycobacterium tuberculosis TB Ag85A protein (His tag) (AB240770)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab240770 could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis Ag85A.

Mass Spectrometry - Recombinant Mycobacterium tuberculosis TB Ag85A protein (His tag) (AB240770)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Mycobacterium tuberculosis TB Ag85A protein (His tag) (AB240770)

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result ab240770 could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis Ag85A.

SDS-PAGE - Recombinant Mycobacterium tuberculosis TB Ag85A protein (His tag) (AB240770)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Mycobacterium tuberculosis TB Ag85A protein (His tag) (AB240770)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab240770.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P9WQP2

Animal free

No

Carrier free

No

Species

Mycobacterium tuberculosis CDC1551

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNT","proteinLength":"Fragment","predictedMolecularWeight":"34.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":331,"aminoAcidStart":53,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P9WQP2","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TB Ag85A also known as Antigen 85A is an important protein in Mycobacterium tuberculosis. It has a molecular mass of approximately 30-32 kDa. TB Ag85A is part of the antigen 85 complex which consists of proteins Ag85A Ag85B and Ag85C. This protein actively participates in mycobacterial cell wall synthesis. It catalyzes the transfer of mycolic acids to the cell wall arabinogalactan contributing to the bacteria's protective barrier. Expression occurs heavily in the cell envelope of Mycobacterium tuberculosis enabling vital interactions with the host's immune cells.
Biological function summary

TB Ag85A plays a significant role in the survival and virulence of Mycobacterium tuberculosis within host macrophages. It is part of the antigen 85 complex an important element in the synthesis of the mycobacterial cell envelope. This complex facilitates the interconversion of trehalose monomycolate and trehalose dimycolate critical for granuloma formation. The antigen 85 complex interferes with the host's immune response aiding the persistence of the bacterium. The synthesis and secretion of TB Ag85A by Mycobacterium tuberculosis allow it to adjust and survive hostile intra-host environments.

Pathways

TB Ag85A participates in the lipid biosynthesis pathway integral to cell envelope formation. This pathway plays a fundamental role in maintaining mycobacterial cell wall integrity. TB Ag85A is linked with proteins like Ag85B and Ag85C which are components of the same antigen 85 complex. These proteins work together within the pathway contributing to the robust defense system of Mycobacterium tuberculosis which complicates treatment and eradication efforts.

TB Ag85A is closely connected to tuberculosis a severe infectious disease. The protein's role in cell wall synthesis and immune evasion links it to the pathogen's ability to persist in the host. TB Ag85A's interactions with host immune defenses allow Mycobacterium tuberculosis to survive and proliferate in the lungs. Additionally studies propose TB Ag85A as a potential target for developing vaccines against tuberculosis given its role in infection and immune evasion. Researchers are exploring its connections to Ag85B and Ag85C for novel therapeutic interventions in tuberculosis management.

Specifications

Form

Liquid

General info

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor (By similarity).

Sequence similarities

Belongs to the mycobacterial A85 antigen family.

Product protocols

Target data

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor (By similarity).
See full target information fbpA

Additional targets

TB Ag85A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com