JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB256066

Recombinant Pig IL-8 protein (Animal Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Pig IL-8 protein (Animal Free) is a Pig Full Length protein, in the 26 to 103 aa range, expressed in Escherichia coli, with >95%, <1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

IL8, CXCL8, Interleukin-8, IL-8, Alveolar macrophage chemotactic factor I, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, AMCF-I

1 Images
SDS-PAGE - Recombinant Pig IL-8 protein (Animal Free) (AB256066)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Pig IL-8 protein (Animal Free) (AB256066)

SDS-PAGE analysis of 1 μg ab256066 under reducing (Lane 2) and non-reducing (Lane 1) conditions. Porcine IL-8 is predicted to have a MW of 9.1 kDa.

4-20% Tris-Glycine gel, stained with Coomassie Blue.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P26894

Animal free

Yes

Carrier free

No

Species

Pig

Reconstitution

Reconstitute at 0.1 mg/mL in water

Storage buffer

Constituents: 0.12% Sodium chloride, 0.08% Sodium phosphate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ","proteinLength":"Full Length","predictedMolecularWeight":"9.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":103,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P26894","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IL-8 also known as CXCL8 is a cytokine with a molecular weight of approximately 8 kDa. It belongs to the CXC chemokine family and plays a role in the recruitment of neutrophils to sites of inflammation. Cells like monocytes macrophages and endothelial cells express IL-8 after activation by pro-inflammatory signals. The protein exhibits high expression in cells associated with the immune response and inflammation serving as a signaling molecule between these cell types.
Biological function summary

IL-8 functions as a chemoattractant for neutrophils and lymphocytes facilitating their movement towards the site of infection or injury. It does not form part of a larger protein complex but operates individually to enhance immune cell migration. IL-8 possesses unique binding motifs allowing it to interact with specific receptors namely CXCR1 and CXCR2 on target cells. This binding triggers cellular responses leading to effective immune surveillance and response to inflammatory stimuli.

Pathways

IL-8 operates within important inflammatory and immune response pathways. It forms a part of the NF-κB signaling cascade which activates in response to stress signals promoting the expression of other inflammatory mediators. Additionally it engages in the mitogen-activated protein kinase (MAPK) pathway influencing cellular responses such as proliferation and differentiation. The interaction of IL-8 with these pathways highlights its role in modulating immune responses and highlights its interaction with other proteins such as TNF-α and IL-1β.

IL-8 shows a strong association with conditions like rheumatoid arthritis and chronic obstructive pulmonary disease (COPD). It acts as a biomarker for these diseases often correlating with disease severity and inflammation levels. In rheumatoid arthritis IL-8 contributes to joint inflammation and degradation while in COPD it enhances airway inflammation and tissue damage. The cytokine's involvement in these diseases connects it with other inflammatory mediators such as MMPs and leukotrienes which collectively exacerbate disease pathology.

Specifications

Form

Lyophilized

General info

Function

Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection. Also plays an important role in neutrophil activation. Released in response to an inflammatory stimulus, exerts its effect by binding to the G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes and endothelial cells. G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptor and activation by IL8 leads to beta and gamma subunits release from Galpha (GNAI2 in neutrophils) and activation of several downstream signaling pathways including PI3K and MAPK pathways.

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Post-translational modifications

Citrullination at Arg-27 prevents proteolysis, and dampens tissue inflammation, it also enhances leukocytosis, possibly through impaired chemokine clearance from the blood circulation.

Product protocols

Target data

Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection. Also plays an important role in neutrophil activation. Released in response to an inflammatory stimulus, exerts its effect by binding to the G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes and endothelial cells. G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptor and activation by IL8 leads to beta and gamma subunits release from Galpha (GNAI2 in neutrophils) and activation of several downstream signaling pathways including PI3K and MAPK pathways.
See full target information CXCL8

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com