JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB225663

Recombinant Rabies Virus Glycoprotein (His tag)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Rabies Virus Glycoprotein (His tag) is a Rabies virus (strain ERA) Fragment protein, in the 20 to 459 aa range, expressed in Escherichia coli, with >90% purity and suitable for SDS-PAGE. The predicted molecular weight of ab225663 protein is 65.6 kDa.

- Save time and ensure accurate results - use our recombinant Rabies Virus Glycoprotein (RABV G) as a control
- Contains N-terminal 6x His-SUMO-tag

View Alternative Names

Glycoprotein, G, Glycoprotein G

1 Images
SDS-PAGE - Recombinant Rabies Virus Glycoprotein (His tag) (AB225663)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Rabies Virus Glycoprotein (His tag) (AB225663)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P03524

Animal free

No

Carrier free

No

Species

Rabies virus ERA

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our recombinant Rabies Virus Glycoprotein (RABV G) ab225663 as a control in SDS-PAGE.


Check out our protein gel staining guide for SDS-PAGE here

Sequence info

[{"linker":null,"sequence":"KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY","proteinLength":"Fragment","predictedMolecularWeight":"65.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":459,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P03524","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Liquid
Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Rabies Virus Glycoprotein (RVG) also known as G protein plays an essential role in the viral entry process. It has a mass of approximately 59 kDa and expresses on the surface of the rabies virus. The RVG mediates the attachment of the virus to the host cell's receptors facilitating fusion with the host cell membrane. This interaction enables the virus to enter the host cell and initiate infection. The glycoprotein is critical in the determination of host range and tissue tropism due to its binding properties.
Biological function summary

The glycoprotein participates in the fusion process between the viral envelope and host cell membrane. This process requires a conformational change in the glycoprotein structure triggering the fusion of the viral and cellular membranes. RVG forms homotrimers becoming part of a functional complex necessary for viral infectivity. It acts as the major antigenic determinant that elicits an immune response in the host making it a target for neutralizing antibodies.

Pathways

RVG plays a significant role in the viral replication and propagation pathway. Its interaction with cell receptors like the nicotinic acetylcholine receptor and neural cell adhesion molecule (NCAM) facilitates viral attachment and entry into nerve cells. This interaction contributes to the virus's neurotropic characteristics. Glycoprotein interaction with non-classical major histocompatibility complex (MHC) class I proteins can modulate host immune response pathways illustrating its diverse involvement in cell signaling.

Rabies virus causes rabies a fatal neurological condition transmitted through the saliva of infected animals. The RVG's role in viral entry makes it a target for developing anti-rabies therapeutics and vaccines. Glycoprotein interactions with proteins like NCAM could provide insight into therapeutic approaches for controlling viral entry into neurons. Understanding this interaction is important in preventing the spread of rabies and developing effective anti-rabies strategies.

General info

Function

Attaches the virus to host cellular receptor, inducing endocytosis of the virion by using different host proteins including TFRC, GRM2 and ITGB1 (By similarity). In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells (By similarity).

Sequence similarities

Belongs to the lyssavirus glycoprotein family.

Post-translational modifications

Glycosylated and palmitoylated by host. Glycosylation is crucial for glycoprotein export at the cell surface.

Product protocols

Target data

Attaches the virus to host cellular receptor, inducing endocytosis of the virion by using different host proteins including TFRC, GRM2 and ITGB1 (By similarity). In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells (By similarity).
See full target information G

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

PloS one 20:e0323823 PubMed40354406

2025

Rabies vaccination induces a CD4+ TEM and CD4+CD8+ TEMRA TH1 phenotype in dogs.

Applications

Unspecified application

Species

Unspecified reactive species

Haeree P Lang,Farah F Almeer,Marc K Jenkins,Steven G Friedenberg
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com