JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB290070

Recombinant Rat EGF Protein (Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Rat EGF Protein (Active) is a Rat Fragment protein, in the 974 to 1026 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

Pro-epidermal growth factor, EGF, Egf

3 Images
Functional Studies - Recombinant Rat EGF Protein (Active) (AB290070)
  • FuncS

Supplier Data

Functional Studies - Recombinant Rat EGF Protein (Active) (AB290070)

Fully biologically active determined by the dose dependent proliferation of Balb/c-3T3 cells. ED50 is ≤ 0.03 ng/ml, corresponding to a specific activity of 3.3 x 10⁷ units/mg. Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3447557-2.

SDS-PAGE - Recombinant Rat EGF Protein (Active) (AB290070)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Rat EGF Protein (Active) (AB290070)

SDS-PAGE analysis of ab290070

HPLC - Recombinant Rat EGF Protein (Active) (AB290070)
  • HPLC

Supplier Data

HPLC - Recombinant Rat EGF Protein (Active) (AB290070)

HPLC analysis of ab290070

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, HPLC, Mass Spec, FuncS

applications

Biologically active

No

Accession

P07522

Animal free

No

Carrier free

No

Species

Rat

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":1026,"aminoAcidStart":974,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P07522","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Epidermal Growth Factor (EGF) also known as urogastrone is a single polypeptide that facilitates cell growth proliferation and differentiation by binding to the Epidermal Growth Factor Receptor (EGFR). The EGF protein is characterized by a relatively small molecular weight of approximately 6.4 kDa. It is expressed in various tissues including the kidney submandibular glands and Brunner's glands in the mouse and other species. The presence of anti-EGF antibodies can further enhance the understanding of its mechanical actions and functions in different organisms.
Biological function summary

The epidermal growth factor plays a pivotal role in the regulation of cell signaling. It functions outside a complex interacting mainly with EGFR located on the cell surface. Upon ligand binding EGF induces the receptor dimerization leading to autophosphorylation which activates intrinsic intracellular signaling cascades. This activation is critical for cellular responses such as DNA synthesis and the progression of the cell cycle. EGF recombinant proteins such as HEGF are utilized in laboratories to examine its biological activity meticulously.

Pathways

EGF engages in key cellular pathways that mediate various essential functions. It significantly activates the MAPK and PI3K-AKT signaling pathways which govern processes such as cell division and survival. These pathways require the participation of several other proteins including Ras Raf and PDK1 which help modulate their downstream effects. The interplay of EGF with associated proteins highlights its importance in maintaining proper signaling dynamics necessary for healthy cellular function. EGF ELISA kits as well as EGF ELISAs are tools developed for robust analysis of its pathway interactions in research and clinical settings.

Altered EGF signaling is associated with increased risk of certain cancers and inflammatory diseases. Overexpression or mutations in the EGF-EGFR axis can lead to the progression of carcinomas such as those found in the lung and breast as well as disorders like psoriasis. These aberrant signaling events are often linked with other proteins such as HER2 and VEGF which can exacerbate disease severity. The study and detection of EGF products therefore offer significant insights into both the progression and potential therapeutic targeting of these conditions.

Specifications

Form

Lyophilized

General info

Function

EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6 (By similarity).

Product protocols

Target data

EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6 (By similarity).
See full target information Egf

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Genome medicine 16:60 PubMed38658971

2024

Single-cell transcriptomics reveal distinct immune-infiltrating phenotypes and macrophage-tumor interaction axes among different lineages of pituitary neuroendocrine tumors.

Applications

Unspecified application

Species

Unspecified reactive species

Shaojian Lin,Yuting Dai,Changxi Han,Tianyi Han,Linfeng Zhao,Renyan Wu,Jianyue Liu,Bo Zhang,Ning Huang,Yanting Liu,Shujing Lai,Jintong Shi,Yu Wang,Meiqing Lou,Jing Xie,Yijun Cheng,Hao Tang,Hong Yao,Hai Fang,Yan Zhang,Xuefeng Wu,Lei Shen,Youqiong Ye,Li Xue,Zhe Bao Wu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com