JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB109681

Recombinant rat IL-17A + IL-17F protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant rat IL-17A + IL-17F protein is a Rat Full Length protein, in the 29 to 161 aa range, expressed in Escherichia coli, with >98%, < 0.1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC, FuncS.

View Alternative Names

Ctla8, Il17, Il17a, Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8, Interleukin-17F, IL-17F, Il17f

2 Images
Western blot - Recombinant rat IL-17A + IL-17F protein (AB109681)
  • WB

Unknown

Western blot - Recombinant rat IL-17A + IL-17F protein (AB109681)

ab109681 used in Western Blot. Figure : 1 ug in each lane (-) non-reducing conditions and (+) reducing conditions in a 4-20% Tris-Glycine gel stained with Coomassie Blue. Rat IL-17AF is a heterodimer with a predicted total MW of 30.7 kDa.

All lanes:

Western blot - Recombinant rat IL-17A + IL-17F protein (ab109681)

false

SDS-PAGE - Recombinant rat IL-17A + IL-17F protein (AB109681)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant rat IL-17A + IL-17F protein (AB109681)

SDS PAGE analysis of ab109681 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

Key facts

Purity

>98% SDS-PAGE

Endotoxin level

< 0.1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, HPLC, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The ED50 of ab109681, as determined by its ability to induce IL-6 production in NIH-3T3 cells, is 7.28ng/mL.

Accession

Q61453

Animal free

No

Carrier free

No

Species

Rat

Reconstitution

Reconstitute at 0.1 mg/mL in water

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA","proteinLength":"Full Length","predictedMolecularWeight":"15.06 kDa","actualMolecularWeight":null,"aminoAcidEnd":161,"aminoAcidStart":29,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q5BJ95","tags":[]},{"sequence":"MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS","proteinLength":"Full Length","predictedMolecularWeight":"15.14 kDa","actualMolecularWeight":null,"aminoAcidEnd":150,"aminoAcidStart":18,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q61453","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle|For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA)
True

Specifications

Form

Lyophilized

Additional notes

Purity Greater than 98% determined by reducing and non-reducing SDS-PAGE.

General info

Function

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation. Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites. In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines. In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells. Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance. Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation. Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis. As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release. In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers. Involved in antiviral host defense through various mechanisms.

Sequence similarities

Belongs to the IL-17 family.

Product protocols

Target data

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation. Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites. In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines. In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells. Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance. Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation. Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis. As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release. In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers. Involved in antiviral host defense through various mechanisms.
See full target information Il17a

Additional targets

Il17f

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com