JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB282393

Recombinant rat IL-17A protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant rat IL-17A protein (Active) is a Rat Full Length protein, in the 18 to 150 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, sELISA, HPLC, Cell Culture.

View Alternative Names

Ctla8, Il17, Il17a, Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8

5 Images
Sandwich ELISA - Recombinant rat IL-17A protein (Active) (AB282393)
  • sELISA

Lab

Sandwich ELISA - Recombinant rat IL-17A protein (Active) (AB282393)

Sandwich ELISA - Recombinant rat IL-17A protein standard curve.

Background subtracted standard curve using Rat IL-17A Antibody Pair - BSA and Azide free (ab242039) and Recombinant rat IL-17A protein (Active) (ab282393) in sandwich ELISA. The ELISA was performed using the components of the corresponding SimpleStep® kit, which uses the same antibody pair with a different formulation and format.

Mass Spectrometry - Recombinant rat IL-17A protein (Active) (AB282393)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant rat IL-17A protein (Active) (AB282393)

Mass determination by ESI-TOF.

Predicted MW is 15062.23 Da (+/- 10 Da by ESI-TOF). Observed MW is 15063.42.

Functional Studies - Recombinant rat IL-17A protein (Active) (AB282393)
  • FuncS

Supplier Data

Functional Studies - Recombinant rat IL-17A protein (Active) (AB282393)

Functional analysis of ab282393.

Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH-3T3 cells.

ED50 for this effect is ≤ 75.83 ng/ml, corresponding to specific activity of 1.32 X 104 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3393274-4

HPLC - Recombinant rat IL-17A protein (Active) (AB282393)
  • HPLC

Supplier Data

HPLC - Recombinant rat IL-17A protein (Active) (AB282393)

HPLC analysis of ab282393.

SDS-PAGE - Recombinant rat IL-17A protein (Active) (AB282393)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant rat IL-17A protein (Active) (AB282393)

SDS-page analysis of ab282393.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, Mass Spec, sELISA, Cell Culture, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent induction of IL-6 secretion in NIH-3T3 cells.

ED50 for this effect is ≤ 75.83 ng/ml, corresponding to specific activity of 1.32 X 104 units/mg.

Accession

Q61453

Animal free

Yes

Carrier free

No

Species

Rat

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "sELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS","proteinLength":"Full Length","predictedMolecularWeight":"15.06 kDa","actualMolecularWeight":null,"aminoAcidEnd":150,"aminoAcidStart":18,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q61453","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Specifications

Form

Lyophilized

Additional notes

=95%  by HPLC

General info

Function

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation. Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites. In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines. In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells. Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance. Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation. Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis. As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release. In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers. Involved in antiviral host defense through various mechanisms.

Sequence similarities

Belongs to the IL-17 family.

Product protocols

Target data

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation. Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites. In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines. In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells. Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance. Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation. Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis. As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release. In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers. Involved in antiviral host defense through various mechanisms.
See full target information Il17a

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com