JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB290092

Recombinant Rat IL-7 Protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Rat IL-7 Protein (Active) is a Rat Full Length protein, in the 26 to 154 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, Mass Spec, SDS-PAGE, FuncS.

View Alternative Names

Interleukin-7, IL-7, Il7

4 Images
Functional Studies - Recombinant Rat IL-7 Protein (Active) (AB290092)
  • FuncS

Supplier Data

Functional Studies - Recombinant Rat IL-7 Protein (Active) (AB290092)

Fully biologically active determined by the dose dependent proliferation of 2E8 cells.  ED50 is ≤ 16.3 ng/ml, corresponding to a specific activity of 6.1 x 10⁴ units/mg. Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3453026-1.

Mass Spectrometry - Recombinant Rat IL-7 Protein (Active) (AB290092)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Rat IL-7 Protein (Active) (AB290092)

Mass determination by ESI-TOF. Predicted MW is 14936.21 Da (+/-10 Da by ESI-TOF). Observed MW is 14938.09 Da.

HPLC - Recombinant Rat IL-7 Protein (Active) (AB290092)
  • HPLC

Supplier Data

HPLC - Recombinant Rat IL-7 Protein (Active) (AB290092)

HPLC analysis of ab290092

SDS-PAGE - Recombinant Rat IL-7 Protein (Active) (AB290092)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Rat IL-7 Protein (Active) (AB290092)

SDS-PAGE analysis of ab290092

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, HPLC, Mass Spec

applications

Biologically active

No

Accession

P56478

Animal free

Yes

Carrier free

No

Species

Rat

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILKGSI","proteinLength":"Full Length","predictedMolecularWeight":"14.94 kDa","actualMolecularWeight":"14.94 kDa","aminoAcidEnd":154,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P56478","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Interleukin-7 (IL-7) also known as IL-7 protein or IL-7 is a cytokine with a critical role in immune system development and function. IL-7 has an approximate molecular mass of 25 kDa and it exhibits expression in several tissues including stromal cells in the bone marrow and thymus. It interacts with its specific receptor IL-7R which consists of the IL-7Rα chain and the common gamma chain (γc) shared with other cytokine receptors. These interactions are important for signaling pathways that support lymphoid tissue homeostasis.
Biological function summary

IL-7 significantly influences lymphocyte development and survival. It is essential for the proliferation and maintenance of T cells particularly thymocytes during T cell maturation and peripheral T cells after they exit the thymus. IL-7 does not form a complex itself but works as a critical single molecule in these processes. IL-7's role is especially noted in the maintenance of naïve and memory T cells important for adaptive immunity.

Pathways

IL-7 activity impacts important immune signaling routes. The cytokine is an important player in the JAK/STAT signaling pathway which gets activated upon IL-7R engagement. This pathway is fundamental in controlling T cell development proliferation and survival. IL-7's interaction with other proteins such as the IL-7R complex and their downstream signaling partners integrates it into networks critical for strengthening the immune response.

IL-7 is significantly linked to immunodeficiencies and cancers affecting immune cells. For instance IL-7's altered signaling is associated with severe combined immunodeficiencies (SCID) where the lack of functional IL-7 or its receptor compromises T cell development. Additionally overexpression of IL-7 has connections to certain leukemias and lymphomas where it may contribute to inappropriate lymphocyte proliferation. In these contexts IL-7 often gets investigated alongside proteins such as the JAK and STAT family involved in tumorigenesis and immune dysregulation.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >=95%

General info

Function

Hematopoietic cytokine that plays an essential role in the development, expansion, and survival of naive and memory T-cells and B-cells thereby regulating the number of mature lymphocytes and maintaining lymphoid homeostasis. Mechanistically, exerts its biological effects through a receptor composed of IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Binding to the receptor leads to activation of various kinases including JAK1 or JAK3 depending on the cell type and subsequently propagation of signals through activation of several downstream signaling pathways including the PI3K/Akt/mTOR or the JAK-STAT5.

Sequence similarities

Belongs to the IL-7/IL-9 family.

Post-translational modifications

Three disulfide bonds are present.

Product protocols

Target data

Hematopoietic cytokine that plays an essential role in the development, expansion, and survival of naive and memory T-cells and B-cells thereby regulating the number of mature lymphocytes and maintaining lymphoid homeostasis. Mechanistically, exerts its biological effects through a receptor composed of IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Binding to the receptor leads to activation of various kinases including JAK1 or JAK3 depending on the cell type and subsequently propagation of signals through activation of several downstream signaling pathways including the PI3K/Akt/mTOR or the JAK-STAT5.
See full target information Il7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com