JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB75477

Recombinant rat IP10 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant rat IP10 protein is a Rat Full Length protein, in the 22 to 98 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, WB, FuncS.

View Alternative Names

Inp10, Mob1, Scyb10, Cxcl10, C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, Interferon-inducible protein 10, Protein Mob-1, Small-inducible cytokine B10, Gamma-IP10, IP-10

1 Images
Western blot - Recombinant rat IP10 protein (AB75477)
  • WB

Unknown

Western blot - Recombinant rat IP10 protein (AB75477)

All lanes:

Western blot - Anti-IP10 antibody (<a href='/en-us/products/primary-antibodies/ip10-antibody-ab9807'>ab9807</a>) at 1 µg/mL

All lanes:

Western blot - Recombinant rat IP10 protein (ab75477) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 10 kDa

true

Exposure time: 30s

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, WB, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Active

Accession

P48973

Animal free

No

Carrier free

No

Species

Rat

Reconstitution

Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab75477 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/ip10-antibody-ab9807'>ab9807</a>.</p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":98,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P48973","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

IP10 also known as CXCL10 is a small cytokine belonging to the CXC chemokine family. It has a molecular mass of approximately 8.7 kDa. IP10 is secreted by several cell types such as monocytes endothelial cells and fibroblasts in response to interferon-gamma (IFN-γ). This protein is involved in immune responses and exhibits various roles especially in chemoattracting cells. Researchers often measure IP10 concentrations using ELISA kits such as the IP-10 ELISA to study its expression levels in different biological contexts.
Biological function summary

IP10 plays a role in modulating the activities of immune cells. It attracts T cells eosinophils monocytes and natural killer (NK) cells by binding to the CXCR3 receptor. IP10 is not part of a larger complex but interacts with other cytokines to influence cell migration and the immune response. High levels of IP10 can reflect strong immune activation which is why it is often measured in inflammatory conditions using standard assays like the IP-10 ELISA kits.

Pathways

The role of IP10 lies within the Th1-type immune response pathway. In this pathway IP10 works alongside other chemokines to recruit and activate immune cells to sites of inflammation or infection. It synergizes with IFN-γ to propagate immune signals. IP10 is also linked with the CXCR3 receptor which plays a critical role in these pathways providing a connection to other proteins such as CXCL9 and CXCL11 which have similar functions in cell-mediated immunity.

IP10 is associated with conditions like multiple sclerosis and rheumatoid arthritis. Elevated IP10 levels often correlate with disease activity in these disorders making it a potential biomarker for disease progression. The protein interacts with other inflammatory mediators such as TNF-α in regulating immune activity within these disease contexts. IP10's involvement in recruiting immune cells contributes to the pathogenic inflammation observed in these conditions.

Specifications

Form

Lyophilized

Additional notes

Purity : Greater than 98% by SDS-PAGE gel and HPLC analyses.Endotoxin level is less than 0.1 ng per µg (1EU/µg).

General info

Function

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (By similarity). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (By similarity). Activation of the CXCL10/CXCR3 axis also plays an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity) (PubMed : 30257241, PubMed : 30448292).

Sequence similarities

Belongs to the intercrine alpha (chemokine CxC) family.

Product protocols

Target data

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (By similarity). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (By similarity). Activation of the CXCL10/CXCR3 axis also plays an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity) (PubMed : 30257241, PubMed : 30448292).
See full target information Cxcl10

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com