JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307410

Recombinant Rat M-CSF Protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Rat M-CSF Protein (Active) is a Rat Fragment protein, in the 33 to 190 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, HPLC, FuncS.

View Alternative Names

Csfm, Csf1, Macrophage colony-stimulating factor 1, CSF-1, MCSF, Proteoglycan macrophage colony-stimulating factor, PG-M-CSF

4 Images
Biological Activity - Recombinant Rat M-CSF Protein (Active) (AB307410)
  • Biological Activity

Lab

Biological Activity - Recombinant Rat M-CSF Protein (Active) (AB307410)

Fully biologically active determined by the dose dependent proliferation of M-NFS-60 cells. ED50 is ≤ 1.8 ng/ml, corresponding to a specific activity of 5.5 x 10^5 units/mg.

Mass Spectrometry - Recombinant Rat M-CSF Protein (Active) (AB307410)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Rat M-CSF Protein (Active) (AB307410)

Mass determination by ESI-TOF. Predicted MW is 18505.07 Da (+/-10 Da by ESI-TOF). Observed MW is 18506.60 Da.

SDS-PAGE - Recombinant Rat M-CSF Protein (Active) (AB307410)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Rat M-CSF Protein (Active) (AB307410)

SDS-PAGE analysis of ab307410

HPLC - Recombinant Rat M-CSF Protein (Active) (AB307410)
  • HPLC

Supplier Data

HPLC - Recombinant Rat M-CSF Protein (Active) (AB307410)

HPLC analysis of ab307410

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, SDS-PAGE, HPLC, FuncS

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of M-NFS-60 cells. ED50 is ≤ 1.8 ng/ml, corresponding to a specific activity of 5.5 x 105 units/mg.

Accession

Q8JZQ0

Animal free

Yes

Carrier free

No

Species

Rat

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"" } } }

Sequence info

[{"sequence":"EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNC","proteinLength":"Fragment","predictedMolecularWeight":"18.5 kDa","actualMolecularWeight":"18.5 kDa","aminoAcidEnd":190,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q8JZQ0","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

M-CSF or macrophage colony-stimulating factor is a cytokine involved in the regulation of macrophage production. Alternative names for M-CSF include CSF-1 and colony-stimulating factor 1. The M-CSF protein has a molecular mass of approximately 18 to 22 kDa. M-CSF is mainly expressed in various tissues including the placenta kidney and bone marrow. It functions as a homodimer important for the survival proliferation and differentiation of mononuclear phagocyte lineage cells.
Biological function summary

M-CSF influences the production differentiation and function of macrophages and osteoclasts. It is not part of a large complex but interacts with its receptor the CSF1R (colony-stimulating factor 1 receptor) on the surface of target cells. This interaction promotes the survival and proliferation of the target cells playing significant roles in immune response and bone homeostasis by regulating osteoclast development.

Pathways

The interaction of M-CSF with its receptor is central to several biological pathways notably the immune system pathway and bone resorption pathway. Within these pathways the binding of M-CSF to CSF1R activates downstream signaling cascades such as the PI3K/AKT and MAPK pathways importantly affecting cell survival and differentiation. The M-CSF pathway intersects with other cytokines and factors like GM-CSF (granulocyte-macrophage colony-stimulating factor) which also regulate immune cell dynamics.

Dysregulation of M-CSF levels is implicated in conditions such as osteoporosis and certain cancers. In osteoporosis M-CSF's role in osteoclast development links to increased bone resorption leading to bone loss. In cancers M-CSF overexpression may facilitate tumor-associated macrophage infiltration therefore supporting tumor progression. The interaction with CSF1R is significant as it serves as a potential target for therapeutic strategies aimed at modulating macrophage activity in these diseases.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >= 95%

General info

Function

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance (By similarity).

Post-translational modifications

N-glycosylated.. O-glycosylated; contains chondroitin sulfate.

Product protocols

Target data

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance (By similarity).
See full target information Csf1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com