JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271655

Recombinant Rat PCSK9 protein (His tag C-Terminus + Avi tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Rat PCSK9 protein (His tag C-Terminus + Avi tag C-Terminus) is a Rat Full Length protein, in the 31 to 691 aa range, expressed in HEK 293 cells, with >67%, suitable for SDS-PAGE.

View Alternative Names

Narc1, Pcsk9, Proprotein convertase subtilisin/kexin type 9, Neural apoptosis-regulated convertase 1, Proprotein convertase 9, Subtilisin/kexin-like protease PC9, NARC-1, PC9

1 Images
SDS-PAGE - Recombinant Rat PCSK9 protein (His tag C-Terminus + Avi tag C-Terminus) (AB271655)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Rat PCSK9 protein (His tag C-Terminus + Avi tag C-Terminus) (AB271655)

SDS-PAGE analysis of 4 μg ab271655.

Key facts

Purity

>67% SDS-PAGE

Expression system

HEK 293 cells

Tags

His tag C-Terminus Avi tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P59996

Animal free

No

Carrier free

No

Species

Rat

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQ","proteinLength":"Full Length","predictedMolecularWeight":"76 kDa","actualMolecularWeight":null,"aminoAcidEnd":691,"aminoAcidStart":31,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P59996","tags":[{"tag":"His","terminus":"C-Terminus"},{"tag":"Avi","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a protein responsible for the regulation of cholesterol levels by binding to low-density lipoprotein receptors (LDLR) on hepatocytes. This interaction marks the LDLRs for degradation reducing the liver's ability to clear LDL cholesterol from the blood. PCSK9 has a molecular weight of approximately 74 kDa. The protein is mainly expressed in the liver but is also found in the intestine and kidneys. PCSK9 is referred to as NARC-1 standing for neural apoptosis-regulated convertase 1 highlighting its role in the liver's cholesterol management system.
Biological function summary

PCSK9 influences cholesterol homeostasis by its important role in degrading LDL receptors. It functions independently rather than as part of larger protein complexes. PCSK9 gains particular interest in therapeutic contexts where its inhibition can lead to increased LDLR levels and enhanced clearance of LDL cholesterol. Biotinylated PCSK9 and mouse PCSK9 variants provide significant tools for experimental study. Kits such as the PCSK9 ELISA kit enable detailed measurement of PCSK9 levels in blood samples providing insights into cholesterol metabolism dynamics.

Pathways

PCSK9 operates within the lipid metabolism pathway and the cholesterol biosynthesis pathway. The protein's activity affects the fate of LDL cholesterol within these pathways. It interacts with proteins such as apolipoprotein B (ApoB) which plays a central role in the structural component of LDL particles. The modulation of these pathways by PCSK9 highlights the significance of its function in maintaining cardiovascular health and managing cholesterol levels.

PCSK9 is closely linked to hypercholesterolemia and coronary artery disease. Mutations in PCSK9 can lead to autosomal dominant hypercholesterolemia due to its effect on LDL receptor degradation. Other proteins such as ApoB and LDLR are involved in these conditions tightly interacting with PCSK9's regulatory function. A better understanding of PCSK9's role offers potential therapeutic targets for cardiovascular disease interventions especially through the development of PCSK9 antibodies and PCSK9 assays that adjust cholesterol levels.

Specifications

Form

Liquid

General info

Function

Crucial player in the regulation of plasma cholesterol homeostasis. Binds to low-density lipid receptor family members : low density lipoprotein receptor (LDLR), very low density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER) and apolipoprotein receptor 2 (LRP8/APOER2), and promotes their degradation in intracellular acidic compartments. Acts via a non-proteolytic mechanism to enhance the degradation of the hepatic LDLR through a clathrin LDLRAP1/ARH-mediated pathway. May prevent the recycling of LDLR from endosomes to the cell surface or direct it to lysosomes for degradation. Can induce ubiquitination of LDLR leading to its subsequent degradation. Inhibits intracellular degradation of APOB via the autophagosome/lysosome pathway in a LDLR-independent manner. Involved in the disposal of non-acetylated intermediates of BACE1 in the early secretory pathway. Inhibits epithelial Na(+) channel (ENaC)-mediated Na(+) absorption by reducing ENaC surface expression primarily by increasing its proteasomal degradation. Regulates neuronal apoptosis via modulation of LRP8/APOER2 levels and related anti-apoptotic signaling pathways (By similarity).

Sequence similarities

Belongs to the peptidase S8 family.

Post-translational modifications

Cleavage by furin and PCSK5 generates a truncated inactive protein that is unable to induce LDLR degradation.. Undergoes autocatalytic cleavage in the endoplasmic reticulum to release the propeptide from the N-terminus and the cleavage of the propeptide is strictly required for its maturation and activation. The cleaved propeptide however remains associated with the catalytic domain through non-covalent interactions, preventing potential substrates from accessing its active site. As a result, it is secreted from cells as a propeptide-containing, enzymatically inactive protein (By similarity).. Phosphorylation protects the propeptide against proteolysis.

Subcellular localisation

Endosome

Product protocols

Target data

Crucial player in the regulation of plasma cholesterol homeostasis. Binds to low-density lipid receptor family members : low density lipoprotein receptor (LDLR), very low density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER) and apolipoprotein receptor 2 (LRP8/APOER2), and promotes their degradation in intracellular acidic compartments. Acts via a non-proteolytic mechanism to enhance the degradation of the hepatic LDLR through a clathrin LDLRAP1/ARH-mediated pathway. May prevent the recycling of LDLR from endosomes to the cell surface or direct it to lysosomes for degradation. Can induce ubiquitination of LDLR leading to its subsequent degradation. Inhibits intracellular degradation of APOB via the autophagosome/lysosome pathway in a LDLR-independent manner. Involved in the disposal of non-acetylated intermediates of BACE1 in the early secretory pathway. Inhibits epithelial Na(+) channel (ENaC)-mediated Na(+) absorption by reducing ENaC surface expression primarily by increasing its proteasomal degradation. Regulates neuronal apoptosis via modulation of LRP8/APOER2 levels and related anti-apoptotic signaling pathways (By similarity).
See full target information Pcsk9

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com