JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB307188

Recombinant Rat RAGE protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Rat RAGE protein (Fc Chimera) is a Rat Fragment protein, in the 23 to 341 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC, Mass Spec.

View Alternative Names

Rage, Ager, Advanced glycosylation end product-specific receptor, Receptor for advanced glycosylation end products

3 Images
Mass Spectrometry - Recombinant Rat RAGE protein (Fc Chimera) (AB307188)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Rat RAGE protein (Fc Chimera) (AB307188)

Mass determination by ESI-TOF. Predicted MW is 59810.06 Da (+/- 10 Da by ESI-TOF). Observed MW is 59813 Da.

HPLC - Recombinant Rat RAGE protein (Fc Chimera) (AB307188)
  • HPLC

Supplier Data

HPLC - Recombinant Rat RAGE protein (Fc Chimera) (AB307188)

HPLC analysis of ab307188

SDS-PAGE - Recombinant Rat RAGE protein (Fc Chimera) (AB307188)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Rat RAGE protein (Fc Chimera) (AB307188)

SDS-page analysis of ab307188

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

Mass Spec, HPLC, SDS-PAGE

applications

Biologically active

No

Accession

Q63495

Animal free

Yes

Carrier free

No

Species

Rat

Reconstitution

Lyophilized contents may appear as either a translucent film or a white powder. This variance does not affect the quality of the product. Store lyophilized form at room temperature. Reconstitute in phosphate buffered saline, aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw.

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEAWKVLSPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIPGKPEIVNPASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHPETGLFTLRSELTVTPAQGGTTPTYSCSFSLGLPRRRPLNTAPIQPRVREPLPPEGIQLLVEPEGGTVAPGGTVTLTCAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCVATHPSHGPQESPPVNIRVTETGDEGQAAGSVDGSGLGTLAL","proteinLength":"Fragment","predictedMolecularWeight":"59.81 kDa","actualMolecularWeight":"59.81 kDa","aminoAcidEnd":341,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q63495","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

RAGE also known as Receptor for Advanced Glycation End-products is a multi-ligand cell surface receptor with a molecular weight of approximately 45 kDa. It belongs to the immunoglobulin superfamily consisting of three extracellular immunoglobulin-like domains a transmembrane domain and a cytoplasmic tail. RAGE is widely expressed in various tissues throughout the body with high expression levels in the lungs heart and cells of the nervous system. The receptor can interact with several ligands such as advanced glycation end-products (AGEs) amyloid beta and S100/calgranulin proteins facilitating signal transduction into the cells.
Biological function summary

RAGE functions in the immune and inflammatory response where it mediates cell signaling that leads to cellular activation and the release of pro-inflammatory cytokines. It acts as part of complexes with different proteins contributing to cellular processes such as proliferation and migration. RAGE also plays roles in the regulation of oxidative stress and apoptosis impacting cellular health and survival. Researchers employ tools like 'anti-RAGE' antibodies and 'RAGER ELISA' assays to measure and study RAGE expression levels and its interactions in various experimental setups.

Pathways

RAGE is significantly involved in the NF-kB pathway and the MAPK signaling cascade. Its activation can lead to the release of NF-kB a transcription factor that plays an essential role in immune and inflammatory responses. RAGE interacts with proteins such as p38 MAPK leading to a cascade of events that regulate inflammation and stress responses. The signaling pathways involving RAGE are important in maintaining cell homeostasis and responding to cellular stressors and tools like 'anti-RAGE' and 'mouse RAGE' antibodies serve to elucidate these complex pathways further.

RAGE has strong associations with chronic diseases like diabetes and Alzheimer's disease. In diabetes RAGE binds to AGEs contributing to inflammation and vascular complications where it often interacts with proteins like iNOS and VEGF. In Alzheimer's disease RAGE is implicated in the accumulation and toxicity of amyloid-beta peptides interacting with proteins such as APP and tau. Understanding RAGE's role in these diseases can aid in developing therapeutic strategies employing reagents such as 'phen RAGE' and 'anti-RAGE' for targeted treatment approaches.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >=95%

General info

Function

Cell surface pattern recognition receptor that senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PubMed : 19910580, PubMed : 28627626). Advanced glycosylation end products are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. These ligands accumulate at inflammatory sites during the pathogenesis of various diseases, including diabetes, vascular complications, neurodegenerative disorders, and cancers and RAGE transduces their binding into pro-inflammatory responses. Upon ligand binding, uses TIRAP and MYD88 as adapters to transduce the signal ultimately leading to the induction or inflammatory cytokines IL6, IL8 and TNFalpha through activation of NF-kappa-B. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key pro-inflammatory mediators (By similarity). Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Participates in endothelial albumin transcytosis together with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability. Mediates the loading of HMGB1 in extracellular vesicles (EVs) that shuttle HMGB1 to hepatocytes by transferrin-mediated endocytosis and subsequently promote hepatocyte pyroptosis by activating the NLRP3 inflammasome. Promotes also extracellular hypomethylated DNA (CpG DNA) uptake by cells via the endosomal route to activate inflammatory responses (By similarity).

Post-translational modifications

Phosphorylated on its cytoplasmic domain by PKCzeta/PRKCZ upon ligand binding.. Targeted by the ubiquitin E3 ligase subunit FBXO10 to mediate its ubiquitination and degradation.

Product protocols

Target data

Cell surface pattern recognition receptor that senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PubMed : 19910580, PubMed : 28627626). Advanced glycosylation end products are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. These ligands accumulate at inflammatory sites during the pathogenesis of various diseases, including diabetes, vascular complications, neurodegenerative disorders, and cancers and RAGE transduces their binding into pro-inflammatory responses. Upon ligand binding, uses TIRAP and MYD88 as adapters to transduce the signal ultimately leading to the induction or inflammatory cytokines IL6, IL8 and TNFalpha through activation of NF-kappa-B. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key pro-inflammatory mediators (By similarity). Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Participates in endothelial albumin transcytosis together with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability. Mediates the loading of HMGB1 in extracellular vesicles (EVs) that shuttle HMGB1 to hepatocytes by transferrin-mediated endocytosis and subsequently promote hepatocyte pyroptosis by activating the NLRP3 inflammasome. Promotes also extracellular hypomethylated DNA (CpG DNA) uptake by cells via the endosomal route to activate inflammatory responses (By similarity).
See full target information Ager

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com